Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7545
Gene name Gene Name - the full gene name approved by the HGNC.
Zic family zinc finger 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZIC1
Synonyms (NCBI Gene) Gene synonyms aliases
BAIDCS, CRS6, ZIC, ZNF201
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q24
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development. Aberrant expression of this gene is seen in medulloblastoma, a childhood brain tumor. This gene is closely linked to t
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1057517667 C>A Pathogenic Stop gained, coding sequence variant
rs1057517668 C>T Pathogenic Stop gained, coding sequence variant
rs1057517669 G>T Pathogenic Stop gained, coding sequence variant
rs1057517670 G>C Pathogenic Missense variant, coding sequence variant
rs1064794698 C>A,T Likely-pathogenic Stop gained, synonymous variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1513264 hsa-miR-105 CLIP-seq
MIRT1513265 hsa-miR-1179 CLIP-seq
MIRT1513266 hsa-miR-1224-3p CLIP-seq
MIRT1513267 hsa-miR-1231 CLIP-seq
MIRT1513268 hsa-miR-1260 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600470 12872 ENSG00000152977
Protein
UniProt ID Q15915
Protein name Zinc finger protein ZIC 1 (Zinc finger protein 201) (Zinc finger protein of the cerebellum 1)
Protein function Acts as a transcriptional activator. Involved in neurogenesis. Plays important roles in the early stage of organogenesis of the CNS, as well as during dorsal spinal cord development and maturation of the cerebellum. Involved in the spatial distr
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18366 zf_ZIC 218 264 Zic proteins zinc finger domain Domain
PF00096 zf-C2H2 302 326 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 332 356 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 362 384 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: CNS. A high level expression is seen in the cerebellum. Detected in the nuclei of the cerebellar granule cell lineage from the progenitor cells of the external germinal layer to the postmigrated cells of the internal granular layer. De
Sequence
MLLDAGPQYPAIGVTTFGASRHHSAGDVAERDVGLGINPFADGMGAFKLNPSSHELASAG
QTAFTSQAPGYAAAAALGHHHHPGHVGSYSSAAFNSTRDFLFRNRGFGDAAAAASAQHSL
FAASAGGFGGPHGHTDAAGHLLFPGLHEQAAGHASPNVVNGQMRLGFSGDMYPRPEQYGQ
VTSPRSEHYAAPQLHGYGPMNVNMAAHHGAGAFFRYMRQPIKQELICKWIEPEQLANPKK
SCNKTFSTMHELVTHVTVEHVGGP
EQSNHICFWEECPREGKPFKAKYKLVNHIRVHTGEK
PFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDK
PYLCKMCDKSYTHPSSLRKHMKVHESSSQGSQPSPAASSGYESSTPPTIVSPSTDNPTTS
SLSPSSSAVHHTAGHSALSSNFNEWYV
Sequence length 447
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Craniosynostosis craniosynostosis 6 rs1057517670 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Brachycephaly isolated brachycephaly N/A N/A GenCC
Dandy-Walker Syndrome Dandy-Walker syndrome N/A N/A GenCC
Insomnia Insomnia N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 29378629
Anus Neoplasms Associate 30060049
Carcinogenesis Associate 26207911
Carcinoma Hepatocellular Associate 24782033, 33772101
Cerebellar Diseases Associate 35997131
Colorectal Neoplasms Inhibit 21347233, 31392276
Craniosynostoses Associate 27884935
Dandy Walker Syndrome Associate 34238780
Dupuytren Contracture Associate 20676061
Endometrial Neoplasms Associate 21347233