Gene Gene information from NCBI Gene database.
Entrez ID 7538
Gene name ZFP36 ring finger protein
Gene symbol ZFP36
Synonyms (NCBI Gene)
G0S24GOS24NUP475RNF162ATIS11TTPzfp-36
Chromosome 19
Chromosome location 19q13.2
miRNA miRNA information provided by mirtarbase database.
517
miRTarBase ID miRNA Experiments Reference
MIRT004630 hsa-miR-29a-3p Review 20026422
MIRT004632 hsa-miR-29c-3p Review 20026422
MIRT016689 hsa-miR-346 Western blot;qRT-PCR;Other 21611196
MIRT004630 hsa-miR-29a-3p GFP reporter assay 24103357
MIRT004630 hsa-miR-29a-3p Luciferase reporter assay 23401122
Transcription factors Transcription factors information provided by TRRUST V2 database.
4
Transcription factor Regulation Reference
ELK1 Unknown 22433566
SMAD3 Unknown 12754205
SMAD4 Unknown 12754205
STAT3 Activation 21606497
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
85
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 21784977
GO:0000165 Process MAPK cascade IEA
GO:0000165 Process MAPK cascade IMP 15187101
GO:0000165 Process MAPK cascade ISS
GO:0000178 Component Exosome (RNase complex) IDA 11719186
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
190700 12862 ENSG00000128016
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P26651
Protein name mRNA decay activator protein ZFP36 (G0/G1 switch regulatory protein 24) (Growth factor-inducible nuclear protein NUP475) (Tristetraprolin) (Zinc finger protein 36) (Zfp-36)
Protein function Zinc-finger RNA-binding protein that destabilizes several cytoplasmic AU-rich element (ARE)-containing mRNA transcripts by promoting their poly(A) tail removal or deadenylation, and hence provide a mechanism for attenuating protein synthesis (Pu
PDB 4J8S
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00642 zf-CCCH 104 130 Zinc finger C-x8-C-x5-C-x3-H type (and similar) Family
PF00642 zf-CCCH 142 168 Zinc finger C-x8-C-x5-C-x3-H type (and similar) Family
Tissue specificity TISSUE SPECIFICITY: Expressed in both basal and suprabasal epidermal layers (PubMed:27182009). Expressed in epidermal keratinocytes (PubMed:27182009). Expressed strongly in mature dendritic cells (PubMed:18367721). Expressed in immature dendritic cells (a
Sequence
MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTS
LVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRY
GAKCQFAHGL
GELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPV
LRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPL
ARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFE
AGVFAPPQPVAAPRRLPIFNRISVSE
Sequence length 326
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
  Tristetraprolin (TTP, ZFP36) binds and destabilizes mRNA