Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7538
Gene name Gene Name - the full gene name approved by the HGNC.
ZFP36 ring finger protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZFP36
Synonyms (NCBI Gene) Gene synonyms aliases
G0S24, GOS24, NUP475, RNF162A, TIS11, TTP, zfp-36
Disease Acronyms (UniProt) Disease acronyms from UniProt database
TTP
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.2
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004630 hsa-miR-29a-3p Review 20026422
MIRT004632 hsa-miR-29c-3p Review 20026422
MIRT016689 hsa-miR-346 Western blot;qRT-PCR;Other 21611196
MIRT004630 hsa-miR-29a-3p GFP reporter assay 24103357
MIRT004630 hsa-miR-29a-3p Luciferase reporter assay 23401122
Transcription factors
Transcription factor Regulation Reference
ELK1 Unknown 22433566
SMAD3 Unknown 12754205
SMAD4 Unknown 12754205
STAT3 Activation 21606497
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 21784977
GO:0000165 Process MAPK cascade IMP 15187101
GO:0000165 Process MAPK cascade ISS
GO:0000178 Component Exosome (RNase complex) IDA 11719186
GO:0000288 Process Nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay IDA 23644599
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
190700 12862 ENSG00000128016
Protein
UniProt ID P26651
Protein name mRNA decay activator protein ZFP36 (G0/G1 switch regulatory protein 24) (Growth factor-inducible nuclear protein NUP475) (Tristetraprolin) (Zinc finger protein 36) (Zfp-36)
Protein function Zinc-finger RNA-binding protein that destabilizes several cytoplasmic AU-rich element (ARE)-containing mRNA transcripts by promoting their poly(A) tail removal or deadenylation, and hence provide a mechanism for attenuating protein synthesis (Pu
PDB 4J8S
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00642 zf-CCCH 104 130 Zinc finger C-x8-C-x5-C-x3-H type (and similar) Family
PF00642 zf-CCCH 142 168 Zinc finger C-x8-C-x5-C-x3-H type (and similar) Family
Tissue specificity TISSUE SPECIFICITY: Expressed in both basal and suprabasal epidermal layers (PubMed:27182009). Expressed in epidermal keratinocytes (PubMed:27182009). Expressed strongly in mature dendritic cells (PubMed:18367721). Expressed in immature dendritic cells (a
Sequence
MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTS
LVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRY
GAKCQFAHGL
GELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPV
LRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPL
ARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFE
AGVFAPPQPVAAPRRLPIFNRISVSE
Sequence length 326
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
  Tristetraprolin (TTP, ZFP36) binds and destabilizes mRNA
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Arthritis Arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 15944294
Dermatitis Dermatitis rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 15944294
Associations from Text Mining
Disease Name Relationship Type References
Acute Kidney Injury Associate 37396184
Adenocarcinoma Inhibit 19208339
Adenocarcinoma of Lung Inhibit 25541715
Alzheimer Disease Associate 37933012
Arthritis Associate 16262601
Arthritis Rheumatoid Inhibit 17599736
Atherosclerosis Associate 16614304
Autoimmune Diseases Associate 12754205, 16262601, 31817224
Brain Diseases Associate 38212812
Breast Neoplasms Inhibit 19491267, 25541715