Gene Gene information from NCBI Gene database.
Entrez ID 7536
Gene name Splicing factor 1
Gene symbol SF1
Synonyms (NCBI Gene)
BBPD11S636MBBPZCCHC25ZFM1ZNF162
Chromosome 11
Chromosome location 11q13.1
Summary This gene encodes a nuclear pre-mRNA splicing factor. The encoded protein specifically recognizes the intron branch point sequence at the 3` splice site, together with the large subunit of U2 auxiliary factor (U2AF), and is required for the early stages o
miRNA miRNA information provided by mirtarbase database.
278
miRTarBase ID miRNA Experiments Reference
MIRT021119 hsa-miR-186-5p Sequencing 20371350
MIRT046884 hsa-miR-221-3p CLASH 23622248
MIRT044484 hsa-miR-320a CLASH 23622248
MIRT036661 hsa-miR-935 CLASH 23622248
MIRT267768 hsa-miR-3606-3p PAR-CLIP 20371350
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
SOX9 Unknown 12837698
USF1 Unknown 18165439
USF2 Unknown 18165439
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
31
GO ID Ontology Definition Evidence Reference
GO:0000245 Process Spliceosomal complex assembly NAS 8752089
GO:0000389 Process MRNA 3'-splice site recognition TAS 15647371
GO:0000398 Process MRNA splicing, via spliceosome IC 9731529
GO:0000398 Process MRNA splicing, via spliceosome NAS 17024186
GO:0003676 Function Nucleic acid binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601516 12950 ENSG00000168066
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15637
Protein name Splicing factor 1 (Mammalian branch point-binding protein) (BBP) (mBBP) (Transcription factor ZFM1) (Zinc finger gene in MEN1 locus) (Zinc finger protein 162)
Protein function Necessary for the ATP-dependent first step of spliceosome assembly. Binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mRNA. May act as transcription repressor. {ECO:0000269|PubMed:10449420, ECO:0000269|PubMed:8752089, ECO:
PDB 1K1G , 1O0P , 1OPI , 2M09 , 2M0G , 4FXW , 4FXX , 7VH9 , 7VPX , 8PXX
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16275 SF1-HH 18 130 Splicing factor 1 helix-hairpin domain Domain
PF00013 KH_1 137 224 KH domain Domain
PF00098 zf-CCHC 278 293 Zinc knuckle Domain
Tissue specificity TISSUE SPECIFICITY: Detected in lung, ovary, adrenal gland, colon, kidney, muscle, pancreas, thyroid, placenta, brain, liver and heart. {ECO:0000269|PubMed:7912130}.
Sequence
MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIED
LTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALN
PDFKPPADYK
PPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGK
GSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRN
ILKQGIETPEDQNDLR
KMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDP
QSAQDKARMDKEYLSLMAELGEAPVPASVGSTSGPATTPLASAPRPAAPANNPPPPSLMS
TTQSRPPWMNSGPSESRPYHGMHGGGPGGPGGGPHSFPHPLPSLTGGHGGHPMQHNPNGP
PPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPP
PPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLPWQQNTTTTTTSAGTGS
IPPWQQQQAAAAASPGAPQMQGNPTMVPLPPGVQPPLPPGAPPPPPPPPPGSAGMMYAPP
PPPPPPMDPSNFVTMMGMGVAGMPPFGMPPAPPPPPPQN
Sequence length 639
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    mRNA Splicing - Major Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
9
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Neurodevelopmental disorder Likely pathogenic rs1430022410 RCV001780022
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
GOUT GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Lung cancer Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MELANOMA CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
46 XX Testicular Disorders of Sex Development Associate 14689056
★☆☆☆☆
Found in Text Mining only
46 XY female Associate 19439508, 21654157
★☆☆☆☆
Found in Text Mining only
Acromegaly Associate 36497102, 40421250
★☆☆☆☆
Found in Text Mining only
ACTH Secreting Pituitary Adenoma Associate 21467194
★☆☆☆☆
Found in Text Mining only
Addison Disease Associate 11038323, 28624161
★☆☆☆☆
Found in Text Mining only
Adrenal Gland Diseases Associate 21239516, 37432935
★☆☆☆☆
Found in Text Mining only
Adrenal Gland Neoplasms Associate 21239516
★☆☆☆☆
Found in Text Mining only
Adrenal Insufficiency Associate 11038323, 17694559, 19318730, 22100173, 25122490, 28624161
★☆☆☆☆
Found in Text Mining only
Adrenocortical Carcinoma Associate 22427816, 23866946, 23907384, 26772981, 27402544, 28658440, 37129912
★☆☆☆☆
Found in Text Mining only
Allanson Pantzar McLeod syndrome Associate 21163476
★☆☆☆☆
Found in Text Mining only