LDLRAD4 (low density lipoprotein receptor class A domain containing 4)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 753
Gene name Low density lipoprotein receptor class A domain containing 4
Gene symbol LDLRAD4
Synonyms (NCBI Gene)
C18orf1
Chromosome 18
Chromosome location 18p11.21
miRNA miRNA information provided by mirtarbase database.
82
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (82)
miRTarBase ID miRNA Experiments Reference
MIRT017628 hsa-miR-335-5p Microarray 18185580
MIRT022560 hsa-miR-124-3p Microarray 18668037
MIRT721404 hsa-miR-6510-5p HITS-CLIP 19536157
MIRT721403 hsa-miR-7160-3p HITS-CLIP 19536157
MIRT721402 hsa-miR-2114-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (19)
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IBA
GO:0005515 Function Protein binding IPI 24627487, 32296183, 33961781, 35044719
GO:0005768 Component Endosome IEA
GO:0009968 Process Negative regulation of signal transduction IEA
GO:0010719 Process Negative regulation of epithelial to mesenchymal transition IMP 24627487
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
606571 1224 ENSG00000168675
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O15165
Protein name Low-density lipoprotein receptor class A domain-containing protein 4
Protein function Functions as a negative regulator of TGF-beta signaling and thereby probably plays a role in cell proliferation, differentiation, apoptosis, motility, extracellular matrix production and immunosuppression. In the canonical TGF-beta pathway, ZFYV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00057 Ldl_recept_a 13 → 47 Low-density lipoprotein receptor domain class A Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed in lymphocytes. {ECO:0000269|PubMed:19461657}.
Sequence 
MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFN
SELEFAQIIIIVVVVTVMVVVIVCLLNHYKVSTRSFINRPNQSRRREDGLPQEGCLWPSD
SAAPRLGASEIMHAPRSRDRFTAPSFIQRDRFSRFQPTYPYVQHEIDLPPTISLSDGEEP
PPYQGPCTLQLRDPEQQMELNRESVRAPPNRTIFDSDLIDIAMYSGGPCPPSSNSGISAS
TCSSNGRMEGPPPTYSEVMGHHPGASFLHHQRSNAHRGSRLQFQQNNAESTIVPIKGKDR
KPGNLV
Sequence length 306
Interactions View interactions