YY1 (YY1 transcription factor)

Gene
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7528
Gene name Gene Name - the full gene name approved by the HGNC.
YY1 transcription factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
YY1
Synonyms (NCBI Gene) Gene synonyms aliases
DELTA, GADEVS, INO80S, NF-E1, UCRBP, YIN-YANG-1
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q32.2
Summary Summary of gene provided in NCBI Entrez Gene.
YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetylt
SNPs SNP information provided by dbSNP.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(4)
SNP ID Visualize variation Clinical significance Consequence
rs1131692046 A>T Pathogenic Coding sequence variant, stop gained
rs1555368900 AG>- Likely-pathogenic Coding sequence variant, frameshift variant
rs1555370811 TTAAA>- Pathogenic Coding sequence variant, frameshift variant
rs1595309671 G>- Pathogenic Frameshift variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(948)
miRTarBase ID miRNA Experiments Reference
MIRT004968 hsa-miR-31-5p Luciferase reporter assay, qRT-PCR 19524507
MIRT004045 hsa-miR-34a-5p Luciferase reporter assay, Western blot 21182263
MIRT004045 hsa-miR-34a-5p Luciferase reporter assay, Western blot 21182263
MIRT004045 hsa-miR-34a-5p Reporter assay 21182263
MIRT004045 hsa-miR-34a-5p Reporter assay;Proteomics 21566225
Transcription factors
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(11)
Transcription factor Regulation Reference
EP300 Unknown 11486036
HDAC5 Activation 18632988
KAT2B Unknown 11486036
NFKB1 Repression 16784892
NFKB1 Unknown 17438126
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(91)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 9857059
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 1655281, 1946405, 16260628
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000400 Function Four-way junction DNA binding IDA 18026119
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
600013 12856 ENSG00000100811
Protein
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P25490
Protein name Transcriptional repressor protein YY1 (Delta transcription factor) (INO80 complex subunit S) (NF-E1) (Yin and yang 1) (YY-1)
Protein function Multifunctional transcription factor that exhibits positive and negative control on a large number of cellular and viral genes by binding to sites overlapping the transcription start site (PubMed:15329343, PubMed:17721549, PubMed:24326773, PubMe
PDB 1UBD , 1ZNM , 4C5I
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 325 → 347 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 353 → 377 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 383 → 407 Zinc finger, C2H2 type Domain
Sequence 
MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDDDEDGGGGDHG
GGGGHGHAGHHHHHHHHHHHPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDSDG
LRAEDGFEDQILIPVPAPAGGDDDYIEQTLVTVAAAGKSGGGGSSSSGGGRVKKGGGKKS
GKKSYLSGGAGAAGGGGADPGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEE
QIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPH
KGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGC
GKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ
Sequence length 414
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  ATP-dependent chromatin remodeling
Polycomb repressive complex 		  UCH proteinases
DNA Damage Recognition in GG-NER
TFAP2 (AP-2) family regulates transcription of growth factors and their receptors
Estrogen-dependent gene expression
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
gabriele de vries syndrome Gabriele de Vries syndrome rs1131692044, rs1131692045, rs1131692046, rs1131692043, rs1131692163 N/A
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer Metastasis in stage I-III microsatellite instability low/stable colorectal cancer (time to event) N/A N/A GWAS
Dementia Dementia N/A N/A GWAS
Show/Hide Text Mining Associations (133)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Habitual Inhibit 27071480
Abortion Habitual Associate 28750739
Acquired Immunodeficiency Syndrome Associate 10888618
ACTH Secreting Pituitary Adenoma Associate 25787250
Adenocarcinoma Associate 28592290
Adenocarcinoma of Lung Associate 35791393, 36268014
Adenoma Associate 27079615
Adrenal Insufficiency Associate 31705051
Alzheimer Disease Associate 21443683, 33920138
Angiomyolipoma Associate 23705901