Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7514
Gene name Gene Name - the full gene name approved by the HGNC.
Exportin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
XPO1
Synonyms (NCBI Gene) Gene synonyms aliases
CRM-1, CRM1, emb, exp1
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p15
Summary Summary of gene provided in NCBI Entrez Gene.
This cell-cycle-regulated gene encodes a protein that mediates leucine-rich nuclear export signal (NES)-dependent protein transport. The protein specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellula
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1057520009 C>T Likely-pathogenic Missense variant, coding sequence variant
rs1057520010 T>A,G Likely-pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016294 hsa-miR-193b-3p Proteomics 21512034
MIRT020549 hsa-miR-155-5p Proteomics 18668040
MIRT026224 hsa-miR-192-5p Microarray 19074876
MIRT028476 hsa-miR-30a-5p Proteomics 18668040
MIRT031490 hsa-miR-16-5p Proteomics 18668040
Transcription factors
Transcription factor Regulation Reference
MYC Activation 22284678
TP53 Repression 22284678
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000054 Process Ribosomal subunit export from nucleus IMP 12724356
GO:0000055 Process Ribosomal large subunit export from nucleus IBA 21873635
GO:0000055 Process Ribosomal large subunit export from nucleus IMP 12773398
GO:0000056 Process Ribosomal small subunit export from nucleus IBA 21873635
GO:0000056 Process Ribosomal small subunit export from nucleus IMP 12773398
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602559 12825 ENSG00000082898
Protein
UniProt ID O14980
Protein name Exportin-1 (Exp1) (Chromosome region maintenance 1 protein homolog)
Protein function Mediates the nuclear export of cellular proteins (cargos) bearing a leucine-rich nuclear export signal (NES) and of RNAs. In the nucleus, in association with RANBP3, binds cooperatively to the NES on its target protein and to the GTPase RAN in i
PDB 1W9C , 2L1L , 3GB8 , 4BSM , 4BSN , 5DIS , 6TVO , 7B51 , 9B62
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03810 IBN_N 46 112 Importin-beta N-terminal domain Family
PF08389 Xpo1 123 268 Exportin 1-like protein Family
PF18777 CRM1_repeat 345 381 Chromosome region maintenance or exportin repeat Repeat
PF18784 CRM1_repeat_2 405 472 CRM1 / Exportin repeat 2 Repeat
PF18787 CRM1_repeat_3 485 535 CRM1 / Exportin repeat 3 Repeat
PF08767 CRM1_C 709 1027 CRM1 C terminal Family
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, brain, placenta, lung, liver, skeletal muscle, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocytes. Not expressed in the kidney. {ECO:0000269|PubMed:9049309, ECO
Sequence
MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAW
TRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIK
TSSDPTCV
EKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFD
FSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGY
IFETKLISTLIYKFLNVPMFRNVSLKCL
TEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPL
NTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEV
EETEIFKICLEYWNHLAAELY
RESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLM
VSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDT
ERIMTEKL
HNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAII
ASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFV
QVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLL
PNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNV
YKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPL
LDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEE
YPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTL
LQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKIST
SLNPGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLV
QIKEFAG
EDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD
Sequence length 1071
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Ribosome biogenesis in eukaryotes
Nucleocytoplasmic transport
Viral life cycle - HIV-1
Influenza A
Human T-cell leukemia virus 1 infection
  Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Rev-mediated nuclear export of HIV RNA
NEP/NS2 Interacts with the Cellular Export Machinery
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
Deactivation of the beta-catenin transactivating complex
HuR (ELAVL1) binds and stabilizes mRNA
RHO GTPases Activate Formins
MAPK6/MAPK4 signaling
Mitotic Prometaphase
Cyclin A/B1/B2 associated events during G2/M transition
Estrogen-dependent nuclear events downstream of ESR-membrane signaling
EML4 and NUDC in mitotic spindle formation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Atrial fibrillation Atrial Fibrillation rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557
View all (6 more)
29892015
Colorectal neoplasms Colorectal Neoplasms rs28929483, rs63751108, rs28929484, rs63749831, rs63750047, rs63751207, rs63749811, rs1553350126, rs63750875, rs63750955, rs587776706, rs63750871, rs587776715, rs63751466, rs63750049
View all (1682 more)
26619011
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 29610475
Unknown
Disease term Disease name Evidence References Source
Paroxysmal atrial fibrillation Paroxysmal atrial fibrillation 29892015 ClinVar
Atrial Fibrillation Atrial Fibrillation GWAS
Hypertension Hypertension GWAS
Crohn Disease Crohn Disease GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 25242053
Adenomatous Polyposis Coli Associate 15678162
Asthma Associate 35751199
Autism Spectrum Disorder Associate 21750575
Autistic Disorder Associate 21750575
beta Thalassemia Associate 33054049
Brain Damage Chronic Associate 36807877
Breast Neoplasms Associate 33117284
Carcinogenesis Associate 11287420, 12861014, 39178254
Carcinoma Hepatocellular Associate 31088931, 31371628, 33856525, 36791564, 39178254