Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
750
Gene name Gene Name - the full gene name approved by the HGNC.
GAS8 antisense RNA 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GAS8-AS1
Synonyms (NCBI Gene) Gene synonyms aliases
C16orf3
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q24.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a long non-coding RNA (lncRNA) that may function as a tumor suppressor. Mutations in this gene have been identified in human papillary thyroid carcinoma (PTC) patients that abrogate the ability of encoded lncRNA to inhibit cancer cell gr
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605179 1197 ENSG00000221819
Protein
UniProt ID O95177
Protein name Uncharacterized protein GAS8-AS1 (GAS8 antisense RNA 1) (GAS8 antisense gene protein 1)
Family and domains
Sequence
MKLSSAAGQESPGHPHPSPPAWTLKKPSESVAQRAMCSARACPVACPVGCPAACPVGCPI
ACPVSCPVACPVGCPVGSMATAPQGLSPQEWEADRETGSSSHAGTTQCSIHSPSSSSRHL
SRTQT
Sequence length 125
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
autism Autism N/A N/A ClinVar