Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7494
Gene name	X-box binding protein 1
Gene symbol	XBP1
Synonyms (NCBI Gene)	TREB-5TREB5XBP-1XBP2
Chromosome	22
Chromosome location	22q12.1\|22q12
Summary	This gene encodes a transcription factor that regulates MHC class II genes by binding to a promoter element referred to as an X box. This gene product is a bZIP protein, which was also identified as a cellular transcription factor that binds to an enhance

412

Show/Hide all (412)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004462	hsa-miR-127-3p	Luciferase reporter assay	19530237
MIRT006375	hsa-miR-214-3p	ELISAFlowLuciferase reporter assayqRT-PCRWestern blot	22359598
MIRT006375	hsa-miR-214-3p	ELISAFlowLuciferase reporter assayqRT-PCRWestern blot	22359598
MIRT006375	hsa-miR-214-3p	ELISAFlowLuciferase reporter assayqRT-PCRWestern blot	22359598
MIRT006375	hsa-miR-214-3p	ELISAFlowLuciferase reporter assayqRT-PCRWestern blot	22359598
MIRT006375	hsa-miR-214-3p	ELISAFlowLuciferase reporter assayqRT-PCRWestern blot	22359598
MIRT006375	hsa-miR-214-3p	ELISAFlowLuciferase reporter assayqRT-PCRWestern blot	22359598
MIRT022880	hsa-miR-124-3p	Microarray	18668037
MIRT048823	hsa-miR-93-5p	CLASH	23622248
MIRT044687	hsa-miR-320a	CLASH	23622248
MIRT037784	hsa-miR-625-3p	CLASH	23622248
MIRT439138	hsa-let-7c-5p	3'LIFE	25074381
MIRT439138	hsa-let-7c-5p	3'LIFE	25074381
MIRT731734	hsa-miR-30a-3p	Luciferase reporter assayqRT-PCR	26572862
MIRT731734	hsa-miR-30a-3p	Luciferase reporter assayqRT-PCR	26572862
MIRT044687	hsa-miR-320a	Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCRFlow cytometryImmunocytochemistry (ICC)	34112145
MIRT735003	hsa-miR-34a-5p	Luciferase reporter assayWestern blottingNorthern blottingqRT-PCR	32531952
MIRT735436	hsa-miR-330-3p	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry	32386518
MIRT1495169	hsa-miR-1225-3p	CLIP-seq
MIRT1495170	hsa-miR-1251	CLIP-seq
MIRT1495171	hsa-miR-1269	CLIP-seq
MIRT1495172	hsa-miR-1269b	CLIP-seq
MIRT1495173	hsa-miR-1276	CLIP-seq
MIRT1495174	hsa-miR-1287	CLIP-seq
MIRT1495175	hsa-miR-1288	CLIP-seq
MIRT1495176	hsa-miR-1324	CLIP-seq
MIRT1495177	hsa-miR-144	CLIP-seq
MIRT1495178	hsa-miR-145	CLIP-seq
MIRT1495179	hsa-miR-186	CLIP-seq
MIRT1495180	hsa-miR-2054	CLIP-seq
MIRT1495181	hsa-miR-214	CLIP-seq
MIRT1495182	hsa-miR-2682	CLIP-seq
MIRT1495183	hsa-miR-302f	CLIP-seq
MIRT1495184	hsa-miR-3117-3p	CLIP-seq
MIRT1495185	hsa-miR-3119	CLIP-seq
MIRT1495186	hsa-miR-3121-3p	CLIP-seq
MIRT1495187	hsa-miR-3125	CLIP-seq
MIRT1495188	hsa-miR-3126-5p	CLIP-seq
MIRT1495189	hsa-miR-3132	CLIP-seq
MIRT1495190	hsa-miR-3133	CLIP-seq
MIRT1495191	hsa-miR-3135b	CLIP-seq
MIRT1495192	hsa-miR-3148	CLIP-seq
MIRT1495193	hsa-miR-3153	CLIP-seq
MIRT1495194	hsa-miR-3168	CLIP-seq
MIRT1495195	hsa-miR-3169	CLIP-seq
MIRT1495196	hsa-miR-3200-3p	CLIP-seq
MIRT1495197	hsa-miR-320b	CLIP-seq
MIRT1495198	hsa-miR-320d	CLIP-seq
MIRT1495199	hsa-miR-33a	CLIP-seq
MIRT1495200	hsa-miR-33b	CLIP-seq
MIRT1495201	hsa-miR-34a	CLIP-seq
MIRT1495202	hsa-miR-34c-5p	CLIP-seq
MIRT1495203	hsa-miR-3612	CLIP-seq
MIRT1495204	hsa-miR-3616-5p	CLIP-seq
MIRT1495205	hsa-miR-3617	CLIP-seq
MIRT1495206	hsa-miR-3618	CLIP-seq
MIRT1495207	hsa-miR-3619-5p	CLIP-seq
MIRT1495208	hsa-miR-3647-5p	CLIP-seq
MIRT1495209	hsa-miR-3665	CLIP-seq
MIRT1495210	hsa-miR-3682-5p	CLIP-seq
MIRT1495211	hsa-miR-376c	CLIP-seq
MIRT1495212	hsa-miR-3916	CLIP-seq
MIRT1495213	hsa-miR-3934	CLIP-seq
MIRT1495214	hsa-miR-3942-3p	CLIP-seq
MIRT1495215	hsa-miR-3943	CLIP-seq
MIRT1495216	hsa-miR-4271	CLIP-seq
MIRT1495217	hsa-miR-4275	CLIP-seq
MIRT1495218	hsa-miR-4291	CLIP-seq
MIRT1495219	hsa-miR-4313	CLIP-seq
MIRT1495220	hsa-miR-4419a	CLIP-seq
MIRT1495221	hsa-miR-4429	CLIP-seq
MIRT1495222	hsa-miR-4434	CLIP-seq
MIRT1495223	hsa-miR-4438	CLIP-seq
MIRT1495224	hsa-miR-4443	CLIP-seq
MIRT1495225	hsa-miR-449a	CLIP-seq
MIRT1495226	hsa-miR-449b	CLIP-seq
MIRT1495227	hsa-miR-449c	CLIP-seq
MIRT1495228	hsa-miR-4509	CLIP-seq
MIRT1495229	hsa-miR-4510	CLIP-seq
MIRT1495230	hsa-miR-4514	CLIP-seq
MIRT1495231	hsa-miR-4515	CLIP-seq
MIRT1495232	hsa-miR-4516	CLIP-seq
MIRT1495233	hsa-miR-4517	CLIP-seq
MIRT1495234	hsa-miR-4529-3p	CLIP-seq
MIRT1495235	hsa-miR-4531	CLIP-seq
MIRT1495236	hsa-miR-4539	CLIP-seq
MIRT1495237	hsa-miR-4635	CLIP-seq
MIRT1495238	hsa-miR-4645-5p	CLIP-seq
MIRT1495239	hsa-miR-4673	CLIP-seq
MIRT1495240	hsa-miR-4684-5p	CLIP-seq
MIRT1495241	hsa-miR-4690-5p	CLIP-seq
MIRT1495242	hsa-miR-4691-5p	CLIP-seq
MIRT1495243	hsa-miR-4692	CLIP-seq
MIRT1495244	hsa-miR-4694-3p	CLIP-seq
MIRT1495245	hsa-miR-4703-3p	CLIP-seq
MIRT1495246	hsa-miR-4704-5p	CLIP-seq
MIRT1495247	hsa-miR-4709-5p	CLIP-seq
MIRT1495248	hsa-miR-4712-3p	CLIP-seq
MIRT1495249	hsa-miR-4712-5p	CLIP-seq
MIRT1495250	hsa-miR-4716-3p	CLIP-seq
MIRT1495251	hsa-miR-4716-5p	CLIP-seq
MIRT1495252	hsa-miR-4719	CLIP-seq
MIRT1495253	hsa-miR-4725-3p	CLIP-seq
MIRT1495254	hsa-miR-4740-5p	CLIP-seq
MIRT1495255	hsa-miR-4759	CLIP-seq
MIRT1495256	hsa-miR-4764-5p	CLIP-seq
MIRT1495257	hsa-miR-513a-3p	CLIP-seq
MIRT1495258	hsa-miR-513b	CLIP-seq
MIRT1495259	hsa-miR-513c	CLIP-seq
MIRT1495260	hsa-miR-514b-5p	CLIP-seq
MIRT1495261	hsa-miR-522	CLIP-seq
MIRT1495262	hsa-miR-526b	CLIP-seq
MIRT1495263	hsa-miR-539	CLIP-seq
MIRT1495264	hsa-miR-548a-3p	CLIP-seq
MIRT1495265	hsa-miR-548b-3p	CLIP-seq
MIRT1495266	hsa-miR-548e	CLIP-seq
MIRT1495267	hsa-miR-548f	CLIP-seq
MIRT1495268	hsa-miR-548k	CLIP-seq
MIRT1495269	hsa-miR-548n	CLIP-seq
MIRT1495270	hsa-miR-548t	CLIP-seq
MIRT1495271	hsa-miR-550b	CLIP-seq
MIRT1495272	hsa-miR-573	CLIP-seq
MIRT1495273	hsa-miR-600	CLIP-seq
MIRT1495274	hsa-miR-619	CLIP-seq
MIRT1495275	hsa-miR-625	CLIP-seq
MIRT1495276	hsa-miR-633	CLIP-seq
MIRT1495277	hsa-miR-637	CLIP-seq
MIRT1495278	hsa-miR-641	CLIP-seq
MIRT1495279	hsa-miR-650	CLIP-seq
MIRT1495280	hsa-miR-654-3p	CLIP-seq
MIRT1495281	hsa-miR-761	CLIP-seq
MIRT1495282	hsa-miR-770-5p	CLIP-seq
MIRT1495283	hsa-miR-877	CLIP-seq
MIRT1495284	hsa-miR-922	CLIP-seq
MIRT1495285	hsa-miR-934	CLIP-seq
MIRT1495286	hsa-miR-942	CLIP-seq
MIRT1495169	hsa-miR-1225-3p	CLIP-seq
MIRT1495170	hsa-miR-1251	CLIP-seq
MIRT1495171	hsa-miR-1269	CLIP-seq
MIRT1495172	hsa-miR-1269b	CLIP-seq
MIRT1495173	hsa-miR-1276	CLIP-seq
MIRT1495174	hsa-miR-1287	CLIP-seq
MIRT1495175	hsa-miR-1288	CLIP-seq
MIRT1495176	hsa-miR-1324	CLIP-seq
MIRT1495177	hsa-miR-144	CLIP-seq
MIRT1495178	hsa-miR-145	CLIP-seq
MIRT1495180	hsa-miR-2054	CLIP-seq
MIRT1495181	hsa-miR-214	CLIP-seq
MIRT1495182	hsa-miR-2682	CLIP-seq
MIRT2149195	hsa-miR-2909	CLIP-seq
MIRT1495183	hsa-miR-302f	CLIP-seq
MIRT1495184	hsa-miR-3117-3p	CLIP-seq
MIRT1495186	hsa-miR-3121-3p	CLIP-seq
MIRT1495187	hsa-miR-3125	CLIP-seq
MIRT1495188	hsa-miR-3126-5p	CLIP-seq
MIRT1495189	hsa-miR-3132	CLIP-seq
MIRT1495191	hsa-miR-3135b	CLIP-seq
MIRT1495192	hsa-miR-3148	CLIP-seq
MIRT1495193	hsa-miR-3153	CLIP-seq
MIRT2149196	hsa-miR-3162-5p	CLIP-seq
MIRT1495194	hsa-miR-3168	CLIP-seq
MIRT1495195	hsa-miR-3169	CLIP-seq
MIRT1495196	hsa-miR-3200-3p	CLIP-seq
MIRT1495197	hsa-miR-320b	CLIP-seq
MIRT1495198	hsa-miR-320d	CLIP-seq
MIRT1495201	hsa-miR-34a	CLIP-seq
MIRT1495202	hsa-miR-34c-5p	CLIP-seq
MIRT1495204	hsa-miR-3616-5p	CLIP-seq
MIRT1495205	hsa-miR-3617	CLIP-seq
MIRT1495206	hsa-miR-3618	CLIP-seq
MIRT1495207	hsa-miR-3619-5p	CLIP-seq
MIRT1495208	hsa-miR-3647-5p	CLIP-seq
MIRT2149197	hsa-miR-3658	CLIP-seq
MIRT1495209	hsa-miR-3665	CLIP-seq
MIRT1495210	hsa-miR-3682-5p	CLIP-seq
MIRT1495211	hsa-miR-376c	CLIP-seq
MIRT1495212	hsa-miR-3916	CLIP-seq
MIRT1495213	hsa-miR-3934	CLIP-seq
MIRT1495214	hsa-miR-3942-3p	CLIP-seq
MIRT1495215	hsa-miR-3943	CLIP-seq
MIRT1495217	hsa-miR-4275	CLIP-seq
MIRT1495218	hsa-miR-4291	CLIP-seq
MIRT1495219	hsa-miR-4313	CLIP-seq
MIRT1495220	hsa-miR-4419a	CLIP-seq
MIRT1495221	hsa-miR-4429	CLIP-seq
MIRT1495222	hsa-miR-4434	CLIP-seq
MIRT1495223	hsa-miR-4438	CLIP-seq
MIRT1495225	hsa-miR-449a	CLIP-seq
MIRT1495226	hsa-miR-449b	CLIP-seq
MIRT1495227	hsa-miR-449c	CLIP-seq
MIRT1495228	hsa-miR-4509	CLIP-seq
MIRT1495229	hsa-miR-4510	CLIP-seq
MIRT1495230	hsa-miR-4514	CLIP-seq
MIRT1495231	hsa-miR-4515	CLIP-seq
MIRT1495232	hsa-miR-4516	CLIP-seq
MIRT1495233	hsa-miR-4517	CLIP-seq
MIRT1495234	hsa-miR-4529-3p	CLIP-seq
MIRT1495235	hsa-miR-4531	CLIP-seq
MIRT1495236	hsa-miR-4539	CLIP-seq
MIRT1495237	hsa-miR-4635	CLIP-seq
MIRT1495238	hsa-miR-4645-5p	CLIP-seq
MIRT2149198	hsa-miR-4662a-3p	CLIP-seq
MIRT2149199	hsa-miR-4668-5p	CLIP-seq
MIRT1495239	hsa-miR-4673	CLIP-seq
MIRT1495240	hsa-miR-4684-5p	CLIP-seq
MIRT1495241	hsa-miR-4690-5p	CLIP-seq
MIRT1495242	hsa-miR-4691-5p	CLIP-seq
MIRT1495243	hsa-miR-4692	CLIP-seq
MIRT1495244	hsa-miR-4694-3p	CLIP-seq
MIRT1495245	hsa-miR-4703-3p	CLIP-seq
MIRT1495246	hsa-miR-4704-5p	CLIP-seq
MIRT1495247	hsa-miR-4709-5p	CLIP-seq
MIRT1495248	hsa-miR-4712-3p	CLIP-seq
MIRT1495249	hsa-miR-4712-5p	CLIP-seq
MIRT1495251	hsa-miR-4716-5p	CLIP-seq
MIRT1495252	hsa-miR-4719	CLIP-seq
MIRT2149200	hsa-miR-4725-5p	CLIP-seq
MIRT1495254	hsa-miR-4740-5p	CLIP-seq
MIRT1495255	hsa-miR-4759	CLIP-seq
MIRT1495256	hsa-miR-4764-5p	CLIP-seq
MIRT2149201	hsa-miR-504	CLIP-seq
MIRT1495257	hsa-miR-513a-3p	CLIP-seq
MIRT1495258	hsa-miR-513b	CLIP-seq
MIRT1495259	hsa-miR-513c	CLIP-seq
MIRT1495260	hsa-miR-514b-5p	CLIP-seq
MIRT1495261	hsa-miR-522	CLIP-seq
MIRT1495262	hsa-miR-526b	CLIP-seq
MIRT1495264	hsa-miR-548a-3p	CLIP-seq
MIRT1495266	hsa-miR-548e	CLIP-seq
MIRT1495267	hsa-miR-548f	CLIP-seq
MIRT1495268	hsa-miR-548k	CLIP-seq
MIRT1495269	hsa-miR-548n	CLIP-seq
MIRT1495270	hsa-miR-548t	CLIP-seq
MIRT1495271	hsa-miR-550b	CLIP-seq
MIRT1495272	hsa-miR-573	CLIP-seq
MIRT2149202	hsa-miR-577	CLIP-seq
MIRT1495273	hsa-miR-600	CLIP-seq
MIRT1495274	hsa-miR-619	CLIP-seq
MIRT1495276	hsa-miR-633	CLIP-seq
MIRT1495277	hsa-miR-637	CLIP-seq
MIRT1495278	hsa-miR-641	CLIP-seq
MIRT1495280	hsa-miR-654-3p	CLIP-seq
MIRT1495281	hsa-miR-761	CLIP-seq
MIRT1495282	hsa-miR-770-5p	CLIP-seq
MIRT1495283	hsa-miR-877	CLIP-seq
MIRT1495284	hsa-miR-922	CLIP-seq
MIRT1495285	hsa-miR-934	CLIP-seq
MIRT1495286	hsa-miR-942	CLIP-seq
MIRT1495169	hsa-miR-1225-3p	CLIP-seq
MIRT1495170	hsa-miR-1251	CLIP-seq
MIRT1495171	hsa-miR-1269	CLIP-seq
MIRT1495172	hsa-miR-1269b	CLIP-seq
MIRT1495173	hsa-miR-1276	CLIP-seq
MIRT1495174	hsa-miR-1287	CLIP-seq
MIRT1495175	hsa-miR-1288	CLIP-seq
MIRT1495176	hsa-miR-1324	CLIP-seq
MIRT1495177	hsa-miR-144	CLIP-seq
MIRT1495178	hsa-miR-145	CLIP-seq
MIRT1495180	hsa-miR-2054	CLIP-seq
MIRT1495181	hsa-miR-214	CLIP-seq
MIRT1495182	hsa-miR-2682	CLIP-seq
MIRT1495184	hsa-miR-3117-3p	CLIP-seq
MIRT1495186	hsa-miR-3121-3p	CLIP-seq
MIRT1495188	hsa-miR-3126-5p	CLIP-seq
MIRT1495191	hsa-miR-3135b	CLIP-seq
MIRT1495192	hsa-miR-3148	CLIP-seq
MIRT1495194	hsa-miR-3168	CLIP-seq
MIRT1495195	hsa-miR-3169	CLIP-seq
MIRT1495196	hsa-miR-3200-3p	CLIP-seq
MIRT1495197	hsa-miR-320b	CLIP-seq
MIRT1495198	hsa-miR-320d	CLIP-seq
MIRT1495201	hsa-miR-34a	CLIP-seq
MIRT1495202	hsa-miR-34c-5p	CLIP-seq
MIRT1495203	hsa-miR-3612	CLIP-seq
MIRT1495204	hsa-miR-3616-5p	CLIP-seq
MIRT1495207	hsa-miR-3619-5p	CLIP-seq
MIRT1495208	hsa-miR-3647-5p	CLIP-seq
MIRT1495209	hsa-miR-3665	CLIP-seq
MIRT1495210	hsa-miR-3682-5p	CLIP-seq
MIRT1495211	hsa-miR-376c	CLIP-seq
MIRT1495213	hsa-miR-3934	CLIP-seq
MIRT1495214	hsa-miR-3942-3p	CLIP-seq
MIRT1495215	hsa-miR-3943	CLIP-seq
MIRT1495216	hsa-miR-4271	CLIP-seq
MIRT1495217	hsa-miR-4275	CLIP-seq
MIRT1495218	hsa-miR-4291	CLIP-seq
MIRT1495219	hsa-miR-4313	CLIP-seq
MIRT1495220	hsa-miR-4419a	CLIP-seq
MIRT1495221	hsa-miR-4429	CLIP-seq
MIRT1495222	hsa-miR-4434	CLIP-seq
MIRT1495223	hsa-miR-4438	CLIP-seq
MIRT1495224	hsa-miR-4443	CLIP-seq
MIRT1495225	hsa-miR-449a	CLIP-seq
MIRT1495226	hsa-miR-449b	CLIP-seq
MIRT1495227	hsa-miR-449c	CLIP-seq
MIRT1495228	hsa-miR-4509	CLIP-seq
MIRT1495229	hsa-miR-4510	CLIP-seq
MIRT1495230	hsa-miR-4514	CLIP-seq
MIRT1495231	hsa-miR-4515	CLIP-seq
MIRT1495232	hsa-miR-4516	CLIP-seq
MIRT1495233	hsa-miR-4517	CLIP-seq
MIRT1495234	hsa-miR-4529-3p	CLIP-seq
MIRT1495235	hsa-miR-4531	CLIP-seq
MIRT1495236	hsa-miR-4539	CLIP-seq
MIRT1495237	hsa-miR-4635	CLIP-seq
MIRT1495238	hsa-miR-4645-5p	CLIP-seq
MIRT1495239	hsa-miR-4673	CLIP-seq
MIRT1495240	hsa-miR-4684-5p	CLIP-seq
MIRT1495241	hsa-miR-4690-5p	CLIP-seq
MIRT1495242	hsa-miR-4691-5p	CLIP-seq
MIRT1495243	hsa-miR-4692	CLIP-seq
MIRT1495244	hsa-miR-4694-3p	CLIP-seq
MIRT1495245	hsa-miR-4703-3p	CLIP-seq
MIRT1495246	hsa-miR-4704-5p	CLIP-seq
MIRT1495247	hsa-miR-4709-5p	CLIP-seq
MIRT1495248	hsa-miR-4712-3p	CLIP-seq
MIRT1495249	hsa-miR-4712-5p	CLIP-seq
MIRT1495250	hsa-miR-4716-3p	CLIP-seq
MIRT1495253	hsa-miR-4725-3p	CLIP-seq
MIRT2149200	hsa-miR-4725-5p	CLIP-seq
MIRT1495254	hsa-miR-4740-5p	CLIP-seq
MIRT1495255	hsa-miR-4759	CLIP-seq
MIRT1495256	hsa-miR-4764-5p	CLIP-seq
MIRT2149201	hsa-miR-504	CLIP-seq
MIRT1495257	hsa-miR-513a-3p	CLIP-seq
MIRT1495259	hsa-miR-513c	CLIP-seq
MIRT1495260	hsa-miR-514b-5p	CLIP-seq
MIRT1495261	hsa-miR-522	CLIP-seq
MIRT1495264	hsa-miR-548a-3p	CLIP-seq
MIRT1495266	hsa-miR-548e	CLIP-seq
MIRT1495267	hsa-miR-548f	CLIP-seq
MIRT1495268	hsa-miR-548k	CLIP-seq
MIRT1495271	hsa-miR-550b	CLIP-seq
MIRT1495272	hsa-miR-573	CLIP-seq
MIRT1495273	hsa-miR-600	CLIP-seq
MIRT1495274	hsa-miR-619	CLIP-seq
MIRT1495275	hsa-miR-625	CLIP-seq
MIRT1495276	hsa-miR-633	CLIP-seq
MIRT1495277	hsa-miR-637	CLIP-seq
MIRT1495279	hsa-miR-650	CLIP-seq
MIRT1495280	hsa-miR-654-3p	CLIP-seq
MIRT1495281	hsa-miR-761	CLIP-seq
MIRT1495282	hsa-miR-770-5p	CLIP-seq
MIRT1495284	hsa-miR-922	CLIP-seq
MIRT1495286	hsa-miR-942	CLIP-seq
MIRT1495176	hsa-miR-1324	CLIP-seq
MIRT1495223	hsa-miR-4438	CLIP-seq
MIRT1495286	hsa-miR-942	CLIP-seq
MIRT1495178	hsa-miR-145	CLIP-seq
MIRT1495180	hsa-miR-2054	CLIP-seq
MIRT1495182	hsa-miR-2682	CLIP-seq
MIRT1495194	hsa-miR-3168	CLIP-seq
MIRT1495197	hsa-miR-320b	CLIP-seq
MIRT1495198	hsa-miR-320d	CLIP-seq
MIRT1495201	hsa-miR-34a	CLIP-seq
MIRT1495202	hsa-miR-34c-5p	CLIP-seq
MIRT2149197	hsa-miR-3658	CLIP-seq
MIRT1495210	hsa-miR-3682-5p	CLIP-seq
MIRT1495217	hsa-miR-4275	CLIP-seq
MIRT1495221	hsa-miR-4429	CLIP-seq
MIRT1495223	hsa-miR-4438	CLIP-seq
MIRT1495225	hsa-miR-449a	CLIP-seq
MIRT1495226	hsa-miR-449b	CLIP-seq
MIRT1495227	hsa-miR-449c	CLIP-seq
MIRT1495230	hsa-miR-4514	CLIP-seq
MIRT1495233	hsa-miR-4517	CLIP-seq
MIRT1495238	hsa-miR-4645-5p	CLIP-seq
MIRT2149198	hsa-miR-4662a-3p	CLIP-seq
MIRT1495239	hsa-miR-4673	CLIP-seq
MIRT1495242	hsa-miR-4691-5p	CLIP-seq
MIRT1495243	hsa-miR-4692	CLIP-seq
MIRT1495245	hsa-miR-4703-3p	CLIP-seq
MIRT1495249	hsa-miR-4712-5p	CLIP-seq
MIRT1495259	hsa-miR-513c	CLIP-seq
MIRT1495260	hsa-miR-514b-5p	CLIP-seq
MIRT1495268	hsa-miR-548k	CLIP-seq
MIRT1495269	hsa-miR-548n	CLIP-seq
MIRT1495270	hsa-miR-548t	CLIP-seq
MIRT1495271	hsa-miR-550b	CLIP-seq
MIRT2149202	hsa-miR-577	CLIP-seq
MIRT1495276	hsa-miR-633	CLIP-seq
MIRT1495282	hsa-miR-770-5p	CLIP-seq
MIRT1495286	hsa-miR-942	CLIP-seq
MIRT1495182	hsa-miR-2682	CLIP-seq
MIRT1495194	hsa-miR-3168	CLIP-seq
MIRT1495197	hsa-miR-320b	CLIP-seq
MIRT1495198	hsa-miR-320d	CLIP-seq
MIRT1495201	hsa-miR-34a	CLIP-seq
MIRT1495202	hsa-miR-34c-5p	CLIP-seq
MIRT2149197	hsa-miR-3658	CLIP-seq
MIRT1495217	hsa-miR-4275	CLIP-seq
MIRT1495221	hsa-miR-4429	CLIP-seq
MIRT1495223	hsa-miR-4438	CLIP-seq
MIRT1495225	hsa-miR-449a	CLIP-seq
MIRT1495226	hsa-miR-449b	CLIP-seq
MIRT1495227	hsa-miR-449c	CLIP-seq
MIRT1495230	hsa-miR-4514	CLIP-seq
MIRT1495236	hsa-miR-4539	CLIP-seq
MIRT1495238	hsa-miR-4645-5p	CLIP-seq
MIRT2149198	hsa-miR-4662a-3p	CLIP-seq
MIRT1495239	hsa-miR-4673	CLIP-seq
MIRT1495242	hsa-miR-4691-5p	CLIP-seq
MIRT1495243	hsa-miR-4692	CLIP-seq
MIRT1495245	hsa-miR-4703-3p	CLIP-seq
MIRT1495248	hsa-miR-4712-3p	CLIP-seq
MIRT1495259	hsa-miR-513c	CLIP-seq
MIRT1495260	hsa-miR-514b-5p	CLIP-seq
MIRT1495268	hsa-miR-548k	CLIP-seq
MIRT1495269	hsa-miR-548n	CLIP-seq
MIRT1495270	hsa-miR-548t	CLIP-seq
MIRT2149202	hsa-miR-577	CLIP-seq
MIRT1495286	hsa-miR-942	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
ATF6	Unknown	20003459;24269637
BACH2	Repression	24821775
BCL6	Repression	24821775
CEBPB	Activation	19717648
PAX5	Repression	8627152

160

Show/Hide all (160)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	16461360, 25239945, 25280941
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	23184933, 25190803
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	11779464
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISS	20408817
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IDA	2196176
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	ISS
GO:0001558	Process	Regulation of cell growth	IDA	23529610
GO:0001889	Process	Liver development	IEA
GO:0001889	Process	Liver development	ISS
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	25190803
GO:0001935	Process	Endothelial cell proliferation	IDA	23529610
GO:0001935	Process	Endothelial cell proliferation	IEA
GO:0002020	Function	Protease binding	IPI	25239945
GO:0002071	Process	Glandular epithelial cell maturation	IEA
GO:0002639	Process	Positive regulation of immunoglobulin production	IDA	11460154
GO:0002639	Process	Positive regulation of immunoglobulin production	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	1718857
GO:0003700	Function	DNA-binding transcription factor activity	IDA	1903538, 8657566, 31387940
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	1718857, 2321018
GO:0005515	Function	Protein binding	IPI	16461360, 20102225, 23661758, 24670641, 25190803, 25239945, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16461360
GO:0005634	Component	Nucleus	IDA	16461360, 20348923, 20955178
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	23661758
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	16461360, 25190803
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005783	Component	Endoplasmic reticulum	IDA	23529610
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	25239945
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	IDA	20348923
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	23661758
GO:0006366	Process	Transcription by RNA polymerase II	ISS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	ISS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	TAS	22013210
GO:0006914	Process	Autophagy	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006955	Process	Immune response	TAS	1718857, 22013210
GO:0006986	Process	Response to unfolded protein	IEA
GO:0007517	Process	Muscle organ development	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	25656649
GO:0008284	Process	Positive regulation of cell population proliferation	IGI	25656649
GO:0010506	Process	Regulation of autophagy	IEA
GO:0010508	Process	Positive regulation of autophagy	IDA	23184933
GO:0010832	Process	Negative regulation of myotube differentiation	ISS
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IPI	20348923
GO:0030154	Process	Cell differentiation	IEA
GO:0030331	Function	Nuclear estrogen receptor binding	TAS	22013210
GO:0030335	Process	Positive regulation of cell migration	IDA	25656649
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IDA	26315405
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IDA	25239945, 31387940
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	ISS
GO:0031017	Process	Exocrine pancreas development	IEA
GO:0031490	Function	Chromatin DNA binding	IDA	25280941
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	25239945
GO:0031647	Process	Regulation of protein stability	IDA	25190803
GO:0031648	Process	Protein destabilization	IDA	16461360, 25239945
GO:0031648	Process	Protein destabilization	IEA
GO:0031648	Process	Protein destabilization	IMP	25280941
GO:0031670	Process	Cellular response to nutrient	ISS
GO:0032008	Process	Positive regulation of TOR signaling	IMP	25190803
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0032869	Process	Cellular response to insulin stimulus	ISS
GO:0034599	Process	Cellular response to oxidative stress	IDA	25190803
GO:0034976	Process	Response to endoplasmic reticulum stress	IDA	11779464, 16461360, 20348923, 25239945
GO:0034976	Process	Response to endoplasmic reticulum stress	TAS	22013210
GO:0035356	Process	Intracellular triglyceride homeostasis	IEA
GO:0035356	Process	Intracellular triglyceride homeostasis	ISS
GO:0035470	Process	Positive regulation of vascular wound healing	IDA	25656649
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IDA	23529610
GO:0036498	Process	IRE1-mediated unfolded protein response	TAS	22013210, 22934019
GO:0036500	Process	ATF6-mediated unfolded protein response	NAS	32046286
GO:0036503	Process	ERAD pathway	NAS	17765680
GO:0042149	Process	Cellular response to glucose starvation	IEA
GO:0042149	Process	Cellular response to glucose starvation	ISS
GO:0042307	Process	Positive regulation of protein import into nucleus	IDA	25190803
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0042802	Function	Identical protein binding	IPI	20102225, 23661758
GO:0042826	Function	Histone deacetylase binding	ISS	20408817
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	31387940
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	23529610
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044389	Function	Ubiquitin-like protein ligase binding	ISS	20408817
GO:0045348	Process	Positive regulation of MHC class II biosynthetic process	IMP	1903538
GO:0045579	Process	Positive regulation of B cell differentiation	IDA	11460154
GO:0045582	Process	Positive regulation of T cell differentiation	IDA	11460154
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	ISS
GO:0045766	Process	Positive regulation of angiogenesis	IMP	25656649
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	8657566, 11779464, 16461360, 23184933, 25190803, 25239945
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	1903538
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	TAS	22013210
GO:0046982	Function	Protein heterodimerization activity	IDA	1903538
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IDA	23529610
GO:0048666	Process	Neuron development	ISS
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	26315405
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	26315405
GO:0055089	Process	Fatty acid homeostasis	IEA
GO:0055089	Process	Fatty acid homeostasis	ISS
GO:0055092	Process	Sterol homeostasis	IEA
GO:0055092	Process	Sterol homeostasis	ISS
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	IDA	26315405
GO:0060612	Process	Adipose tissue development	IEA
GO:0060612	Process	Adipose tissue development	ISS
GO:0060691	Process	Epithelial cell maturation involved in salivary gland development	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IDA	26315405
GO:0071073	Process	Positive regulation of phospholipid biosynthetic process	TAS	22013210
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	11460154
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0071230	Process	Cellular response to amino acid stimulus	ISS
GO:0071332	Process	Cellular response to fructose stimulus	ISS
GO:0071333	Process	Cellular response to glucose stimulus	ISS
GO:0071353	Process	Cellular response to interleukin-4	IEA
GO:0071353	Process	Cellular response to interleukin-4	ISS
GO:0071375	Process	Cellular response to peptide hormone stimulus	IEA
GO:0071375	Process	Cellular response to peptide hormone stimulus	ISS
GO:0071498	Process	Cellular response to fluid shear stress	IDA	25190803, 25280941
GO:0071499	Process	Cellular response to laminar fluid shear stress	IDA	25280941
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	23661758
GO:1900100	Process	Positive regulation of plasma cell differentiation	IDA	11460154
GO:1900102	Process	Negative regulation of endoplasmic reticulum unfolded protein response	IDA	25239945
GO:1901985	Process	Positive regulation of protein acetylation	IDA	25280941
GO:1902236	Process	Negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IDA	19135031
GO:1903489	Process	Positive regulation of lactation	IEA
GO:1903489	Process	Positive regulation of lactation	ISS
GO:1904294	Process	Positive regulation of ERAD pathway	TAS	22013210
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IDA	26315405
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IDA	26315405
GO:1904754	Process	Positive regulation of vascular associated smooth muscle cell migration	IDA	26315405
GO:1904754	Process	Positive regulation of vascular associated smooth muscle cell migration	IDA	26315405
GO:1990418	Process	Response to insulin-like growth factor stimulus	IEA
GO:1990418	Process	Response to insulin-like growth factor stimulus	ISS
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000347	Process	Positive regulation of hepatocyte proliferation	IEA
GO:2000347	Process	Positive regulation of hepatocyte proliferation	ISS
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IDA	25280941

MIM	HGNC	e!Ensembl
194355	12801	ENSG00000100219

P17861

Protein name

X-box-binding protein 1 (XBP-1) (Tax-responsive element-binding protein 5) (TREB-5) [Cleaved into: X-box-binding protein 1, cytoplasmic form; X-box-binding protein 1, luminal form]

Protein function

Functions as a transcription factor during endoplasmic reticulum (ER) stress by regulating the unfolded protein response (UPR). Required for cardiac myogenesis and hepatogenesis during embryonic development, and the development of secretory tiss

PDB

6R5Q , 6R6G , 6R6P , 6R7Q

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07716	bZIP_2	68 → 122	Basic region leucine zipper	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Expressed in plasma cells in rheumatoid synovium (PubMed:11460154). Over-expressed in primary breast cancer and metastatic breast cancer cells (PubMed:25280941). Isoform 1 and isoform 2 are expressed at higher level in proliferating as

Sequence

MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARK
RQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLR
EKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQL
SPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVP
YQPPFLCQWGRHQPSWKPLMN

Sequence length

261

Interactions

View interactions

	KEGG		Reactome
	Protein processing in endoplasmic reticulum Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Spinocerebellar ataxia Pathways of neurodegeneration - multiple diseases Lipid and atherosclerosis		XBP1(S) activates chaperone genes IRE1alpha activates chaperones ATF6 (ATF6-alpha) activates chaperone genes

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
-	risk factor	rs2269577	RCV000012978
Autosomal dominant polycystic liver disease	Likely benign	rs1394430611, rs570172086, rs528996789	RCV001844944 RCV001844946 RCV001844947
Major affective disorder 7	Uncertain significance	rs1601436804	RCV001001988

Show/Hide Text Mining Associations (136)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acidosis	Stimulate	28134810
Adenoma	Stimulate	17352224
Adenoma	Associate	26066753
Adrenocortical Carcinoma	Associate	27631436
Alzheimer Disease	Associate	23421912, 29725981, 40430038
Amyotrophic Lateral Sclerosis	Stimulate	29725981
Aortic Aneurysm Abdominal	Associate	31239294
Arthralgia	Stimulate	29720240
Arthritis	Stimulate	29720240
Arthritis Rheumatoid	Associate	24387801
Arthritis Rheumatoid	Stimulate	29720240
Asthma	Associate	29064281
Axial osteomalacia	Associate	34698138
Bipolar Disorder	Associate	12949534, 15298659, 15380296, 15927087, 16154272, 16539657, 18771604, 19154631
Breast Neoplasms	Associate	12954762, 12960427, 17352224, 19861963, 20208137, 22681620, 27109102, 28187708, 29339455, 31554371, 32883354, 33291081, 34418985, 35543228, 36997866, 38203358 View all (1 more)
Burkitt Lymphoma	Associate	36012375
Carcinogenesis	Associate	17352224, 26633383
Carcinoma Hepatocellular	Associate	16364319
Cardiovascular Diseases	Associate	36012132
Cataract	Associate	26091066
CD59 Deficiency	Associate	35703068
Cell Transformation Neoplastic	Associate	32418990
Chemical and Drug Induced Liver Injury	Associate	30246717
Cholestasis	Associate	36520816
Cognition Disorders	Associate	23421912
Cognitive Dysfunction	Associate	29276149
Colitis Ulcerative	Associate	32908909, 35185383
Colonic Neoplasms	Associate	36246978
Colorectal Neoplasms	Stimulate	17352224
Colorectal Neoplasms	Inhibit	31227689
Colorectal Neoplasms	Associate	31243264, 32323831, 32888357
COVID 19	Associate	37306512, 40253079
COVID 19	Stimulate	37936693
Crohn Disease	Associate	23300802, 30818349, 31694333
Cystic Fibrosis	Associate	26331676, 31428093
Death	Associate	36768338
Depressive Disorder	Associate	19154631
Depressive Disorder Major	Stimulate	24703171
Drug Related Side Effects and Adverse Reactions	Associate	28991167, 36012375
Dyskinesia Drug Induced	Stimulate	28193519
Eclampsia	Associate	35421066
Endocrine System Diseases	Stimulate	36997866
Endocrine System Diseases	Associate	38203358
Endometrial Neoplasms	Associate	37880674, 39986022
Enterocolitis Necrotizing	Associate	24194940
Epilepsy Tonic Clonic	Associate	19154631
Fetal Growth Retardation	Associate	21907405
Gerstmann Syndrome	Associate	35162967
Glioblastoma	Associate	29311133, 31534165
Glioma	Associate	40621799
Glucose Intolerance	Inhibit	32086613
Glucose Metabolism Disorders	Associate	29554103
Glucosephosphate Dehydrogenase Deficiency	Associate	36348288
Heart Failure	Stimulate	26055788
Hereditary Breast and Ovarian Cancer Syndrome	Associate	17352224
Hodgkin Disease	Associate	21062387, 38479365
Holt Oram syndrome	Associate	34818599
Hypertension	Associate	35421066
Hypoxia	Stimulate	26633383
Hypoxia	Associate	40621799
Hypoxia Brain	Associate	19403667
Idiopathic Pulmonary Fibrosis	Associate	18635891
Idiopathic Pulmonary Fibrosis	Stimulate	34209019
Immune System Diseases	Associate	37054944
Immunoglobulin G4 Related Disease	Associate	28183334, 37561593
Infarction Middle Cerebral Artery	Associate	36348288
Infections	Stimulate	32418990
Infections	Associate	36012375, 37306512
Inflammation	Associate	24387801, 29064281, 30662337, 31428093, 31499005, 35185383, 36012132
Leukemia Biphenotypic Acute	Associate	37753803
Leukemia Myeloid Acute	Associate	19659458
Leukoencephalopathies	Associate	31691183
Liver Diseases	Associate	36520816
Lung Diseases	Associate	17586700
Lung Neoplasms	Associate	15006602, 32576923, 35059734
Lupus Erythematosus Systemic	Associate	36165173
Lymphoma	Associate	16418334, 19176362
Lymphoma B Cell	Associate	36012375
Lymphoma Follicular	Associate	30348636
Lymphoma Large B Cell Diffuse	Associate	19176362
Lymphoma Large B Cell Diffuse	Stimulate	19389935
Lymphoma Non Hodgkin	Associate	29725981, 37505724
Lymphoma Primary Effusion	Associate	19403667, 20980528, 26491160, 36012375
Melanoma	Associate	21423203, 26018731, 28222747
Mental Disorders	Associate	15298659
Metabolic Syndrome	Stimulate	21633399
Metaphyseal chondrodysplasia Schmid type	Associate	28440393
Multi centric Castleman's Disease	Associate	31801863, 34686774
Multiple Myeloma	Associate	12200383, 12969976, 14695887, 19755988, 20421453, 21723843, 21993678, 25743686, 27634301, 28052011, 29089645, 35276027, 37054944
Muscle Neoplasms	Associate	29687616
Myeloproliferative Disorders	Associate	35405004
Myopia	Stimulate	26091066
Myopia	Associate	26351848
Myositis Inclusion Body	Associate	25978849
Nasopharyngeal Carcinoma	Associate	17494074, 28216622
Neoplasm Metastasis	Associate	35059734
Neoplasms	Associate	17352224, 19176362, 24357799, 26633383, 27634301, 28222747, 29089645, 29311133, 29339455, 29440447, 32576923, 33106375, 34818599, 35333353, 35378132, 35405004, 36639835, 39206896 View all (3 more)
Neoplasms	Inhibit	24004452
Neoplasms	Stimulate	35059734
Neoplasms Glandular and Epithelial	Associate	24194940
Neoplasms Plasma Cell	Associate	19176362
Neoplasms Plasma Cell	Stimulate	19389935
Neurotoxicity Syndromes	Associate	22528838
Neurotoxicity Syndromes	Inhibit	23421912
Obesity	Associate	18840627, 27481183
Obesity Maternal	Associate	30006153
Oropharyngeal Neoplasms	Associate	30414263, 31187548
Osteoarthritis	Associate	21294793, 37907740
Osteoporosis	Stimulate	26091066
Osteosarcoma	Associate	26633383
Ovarian Neoplasms	Associate	12960427
Pancreatic Neoplasms	Associate	33517887, 37651191
Periodontitis	Associate	27302879, 29921943, 36894919
Personality Disorders	Associate	25170122
Plasmablastic Lymphoma	Associate	19176362, 19389935
Plasmacytoma	Associate	19389935
Polycystic Ovary Syndrome	Associate	35288480
Pre Eclampsia	Associate	21907405, 24931423, 35421066
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	34831075
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	37753803
Prehypertension	Associate	37753803
Prostatic Neoplasms	Associate	31986411, 37857190
Protein Deficiency	Stimulate	27097866
Pulmonary Arterial Hypertension	Associate	23400395
Pyruvate Carboxylase Deficiency Disease	Associate	19846886
Retinoblastoma	Associate	32641679
Sarcoma Kaposi	Associate	31801863
Schizophrenia	Associate	15298659, 37376599
Scleroderma Diffuse	Associate	23400395
Smooth Muscle Tumor	Associate	31940218
Stomach Neoplasms	Associate	33982777
Tongue Neoplasms	Associate	36639835
Triple Negative Breast Neoplasms	Associate	29440447, 36157217, 39206896, 39986022
Vitiligo	Associate	19543371, 35046957
Waldenstrom Macroglobulinemia	Associate	19220283
Zika Virus Infection	Associate	32039055

XBP1 (X-box binding protein 1)