Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7480
Gene name	Wnt family member 10B
Gene symbol	WNT10B
Synonyms (NCBI Gene)	SHFM6STHAG8WNT-12
Chromosome	12
Chromosome location	12q13.12
Summary	The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog

Show/Hide all (8)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121918349	G>A,C,T	Pathogenic	Missense variant, coding sequence variant, synonymous variant, 3 prime UTR variant
rs763548858	->TGCT	Pathogenic	Coding sequence variant, frameshift variant, intron variant
rs763991433	G>A,C	Likely-pathogenic	Coding sequence variant, stop gained, missense variant
rs766021478	C>T	Pathogenic	Coding sequence variant, stop gained, 3 prime UTR variant
rs776938956	TGT>-	Pathogenic	Inframe deletion, coding sequence variant
rs779326570	C>T	Pathogenic	Intron variant, missense variant, coding sequence variant
rs1163162816	C>G,T	Likely-pathogenic	Splice acceptor variant
rs1592252556	T>G	Likely-pathogenic	Genic upstream transcript variant, upstream transcript variant, missense variant, coding sequence variant, 5 prime UTR variant

Show/Hide all (26)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018883	hsa-miR-335-5p	Microarray	18185580
MIRT027804	hsa-miR-98-5p	Microarray	19088304
MIRT053185	hsa-miR-148a-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	22890324
MIRT463936	hsa-miR-376c-3p	PAR-CLIP	23592263
MIRT463935	hsa-miR-545-5p	PAR-CLIP	23592263
MIRT463934	hsa-miR-17-3p	PAR-CLIP	23592263
MIRT463933	hsa-miR-4450	PAR-CLIP	23592263
MIRT463932	hsa-miR-6740-5p	PAR-CLIP	23592263
MIRT463931	hsa-miR-4260	PAR-CLIP	23592263
MIRT463930	hsa-miR-5572	PAR-CLIP	23592263
MIRT732479	hsa-miR-33b-5p	Immunoprecipitaion (IP)Luciferase reporter assayWestern blotting	32346990
MIRT732592	hsa-miR-7113-5p	ELISAImmunoprecipitaion (IP)MicroarrayWestern blotting	33189141
MIRT463936	hsa-miR-376c-3p	PAR-CLIP	23592263
MIRT463935	hsa-miR-545-5p	PAR-CLIP	23592263
MIRT463934	hsa-miR-17-3p	PAR-CLIP	23592263
MIRT463933	hsa-miR-4450	PAR-CLIP	23592263
MIRT463932	hsa-miR-6740-5p	PAR-CLIP	23592263
MIRT463931	hsa-miR-4260	PAR-CLIP	23592263
MIRT463930	hsa-miR-5572	PAR-CLIP	23592263
MIRT1493554	hsa-miR-2115	CLIP-seq
MIRT1493555	hsa-miR-4685-5p	CLIP-seq
MIRT2369167	hsa-miR-1252	CLIP-seq
MIRT2369168	hsa-miR-3074-5p	CLIP-seq
MIRT2369169	hsa-miR-3185	CLIP-seq
MIRT2369170	hsa-miR-3667-3p	CLIP-seq
MIRT2369171	hsa-miR-370	CLIP-seq

Show/Hide all (65)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000086	Process	G2/M transition of mitotic cell cycle	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0002062	Process	Chondrocyte differentiation	IEP	15135146
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005109	Function	Frizzled binding	IBA
GO:0005125	Function	Cytokine activity	IBA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	NAS	15135146
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IEA
GO:0014835	Process	Myoblast differentiation involved in skeletal muscle regeneration	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030182	Process	Neuron differentiation	ISS
GO:0030217	Process	T cell differentiation	IEA
GO:0030501	Process	Positive regulation of bone mineralization	IEA
GO:0030855	Process	Epithelial cell differentiation	IEA
GO:0030858	Process	Positive regulation of epithelial cell differentiation	IEA
GO:0032434	Process	Regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IMP	17761539
GO:0043403	Process	Skeletal muscle tissue regeneration	IEA
GO:0045165	Process	Cell fate commitment	IBA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045582	Process	Positive regulation of T cell differentiation	IEA
GO:0045598	Process	Regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IDA	10937998
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0045778	Process	Positive regulation of ossification	IEA
GO:0045899	Process	Positive regulation of RNA polymerase II transcription preinitiation complex assembly	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048018	Function	Receptor ligand activity	IC	17761539
GO:0048513	Process	Animal organ development	IEA
GO:0048627	Process	Myoblast development	IEA
GO:0048641	Process	Regulation of skeletal muscle tissue development	IEA
GO:0048741	Process	Skeletal muscle fiber development	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0050821	Process	Protein stabilization	IDA	10937998
GO:0050909	Process	Sensory perception of taste	IEA
GO:0051246	Process	Regulation of protein metabolic process	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051885	Process	Positive regulation of timing of anagen	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	17761539
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060346	Process	Bone trabecula formation	IEA
GO:0061196	Process	Fungiform papilla development	IEA
GO:0071300	Process	Cellular response to retinoic acid	ISS
GO:0071320	Process	Cellular response to cAMP	IEA
GO:0071374	Process	Cellular response to parathyroid hormone stimulus	IEA
GO:0071425	Process	Hematopoietic stem cell proliferation	IDA	9787155
GO:0071425	Process	Hematopoietic stem cell proliferation	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	15190075
GO:1902035	Process	Positive regulation of hematopoietic stem cell proliferation	IEA

MIM	HGNC	e!Ensembl
601906	12775	ENSG00000169884

O00744

Protein name

Protein Wnt-10b (Protein Wnt-12)

Protein function

Member of the Wnt ligand gene family that encodes for secreted proteins, which activate the Wnt signaling cascade. Specifically activates canonical Wnt/beta-catenin signaling and thus triggers beta-catenin/LEF/TCF-mediated transcriptional progra

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00110	wnt	50 → 389	wnt family	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in most adult tissues. Highest levels were found in heart and skeletal muscle. Low levels are found in brain.

Sequence

MLEEPRPRPPPSGLAGLLFLALCSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLG
LCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSP
GPGSSPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPTMGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK

Sequence length

389

Interactions

View interactions

	KEGG		Reactome
	mTOR signaling pathway Wnt signaling pathway Hippo signaling pathway Signaling pathways regulating pluripotency of stem cells Melanogenesis Cushing syndrome Alzheimer disease Pathways of neurodegeneration - multiple diseases Human papillomavirus infection Pathways in cancer Proteoglycans in cancer Basal cell carcinoma Breast cancer Hepatocellular carcinoma Gastric cancer		WNT ligand biogenesis and trafficking

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Split hand-foot malformation 6	Pathogenic; Likely pathogenic	rs2137615101, rs2137611223, rs2137612860, rs121918349, rs561483849, rs2137615131, rs763548858, rs763991433, rs1163162816, rs776938956, rs1231016571, rs1555177994, rs1565715468, rs1592252556	RCV001807920 RCV002264897 RCV002269797 RCV000008069 RCV003228717 RCV003447696 RCV000023161 RCV000625580 RCV000656339 RCV000735854 RCV000785183 RCV000785180 RCV000785181 RCV001027401
Tooth agenesis, selective, 8	Pathogenic	rs779326570, rs766021478	RCV000239578 RCV000239472
WNT10B-related disorder	Pathogenic	rs763991433	RCV004758043

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Malignant tumor of esophagus	Benign	rs77211836	RCV005916522

Show/Hide Text Mining Associations (35)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Anodontia	Associate	27321946, 31914153
Breast Neoplasms	Associate	23372744, 35413424
Calcinosis Cutis	Associate	29281678
Carcinogenesis	Associate	19893992, 25995040
Carcinoma Hepatocellular	Associate	19893992
Carcinoma Renal Cell	Associate	33804101
Corneal endothelial dystrophy type 2	Associate	26370090
Deafness oligodontia syndrome	Associate	27321946
Diastrophic dysplasia	Associate	16942611
Dupuytren Contracture	Associate	16942611
Ectrodactyly	Associate	30622331
Endometrial Neoplasms	Associate	22890324, 9099960
Glioma	Associate	32181818, 33173023
Hereditary Breast and Ovarian Cancer Syndrome	Associate	16441421
Idiopathic Pulmonary Fibrosis	Stimulate	18478089
Juvenile osteoporosis	Inhibit	21308775
Leukemia Myeloid Acute	Associate	33497493
Melanoma	Associate	14514922, 33373316
Multiple Myeloma	Associate	40650009
Muscular Dystrophy Duchenne	Associate	18021006
Neoplasms	Associate	22890324, 25874233, 33373316, 34715892
Neoplasms	Stimulate	25995040
Neoplasms	Inhibit	37047493
Obesity	Associate	37219669
Plasmablastic Lymphoma	Associate	37105495
Polycystic Ovary Syndrome	Associate	33228780
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	17614820, 33497493
Psoriasis	Associate	31089877
Skin Neoplasms	Stimulate	25995040
Squamous Cell Carcinoma of Head and Neck	Associate	19543744
Tetramelic Monodactyly	Associate	30622331
Thyroid Neoplasms	Associate	33650656
Triple Negative Breast Neoplasms	Associate	29281678
Upton Young syndrome	Associate	14514922
Vision Disorders	Associate	26370090

WNT10B (Wnt family member 10B)