Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7478
Gene name Gene Name - the full gene name approved by the HGNC.	Wnt family member 8A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	WNT8A
Synonyms (NCBI Gene) Gene synonyms aliases	WNT8D
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q31.2
Summary Summary of gene provided in NCBI Entrez Gene.	The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog

Show/Hide all(2)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021425	hsa-miR-9-5p	Microarray	17612493
MIRT2369233	hsa-miR-4680-5p	CLIP-seq

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005109	Function	Frizzled binding	IBA	21873635
GO:0005109	Function	Frizzled binding	NAS	11408932
GO:0005125	Function	Cytokine activity	IBA	21873635
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	ISS
GO:0009948	Process	Anterior/posterior axis specification	ISS
GO:0014034	Process	Neural crest cell fate commitment	ISS
GO:0016055	Process	Wnt signaling pathway	TAS
GO:0030182	Process	Neuron differentiation	IBA	21873635
GO:0032526	Process	Response to retinoic acid	NAS	11956596
GO:0044335	Process	Canonical Wnt signaling pathway involved in neural crest cell differentiation	ISS
GO:0045165	Process	Cell fate commitment	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0048018	Function	Receptor ligand activity	IDA	28733458
GO:0048018	Function	Receptor ligand activity	NAS	11408932
GO:0060070	Process	Canonical Wnt signaling pathway	IBA	21873635
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	28733458
GO:0060070	Process	Canonical Wnt signaling pathway	ISS
GO:0060070	Process	Canonical Wnt signaling pathway	NAS	11408932
GO:0061317	Process	Canonical Wnt signaling pathway involved in cardiac muscle cell fate commitment	IEP	20559569
GO:0062009	Process	Secondary palate development	IMP	18413325
GO:0062023	Component	Collagen-containing extracellular matrix	ISS
GO:1904886	Process	Beta-catenin destruction complex disassembly	TAS

MIM	HGNC	e!Ensembl
606360	12788	ENSG00000061492

Protein

UniProt ID

Q9H1J5

Protein name

Protein Wnt-8a (Protein Wnt-8d)

Protein function

Ligand for members of the frizzled family of seven transmembrane receptors. Plays a role in embryonic patterning.

PDB

7KC4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00110	wnt	33 → 337	wnt family	Family

Sequence

MGNLFMLWAALGICCAAFSASAWSVNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAW
ERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYIITKNCSMGDFENCGCDGSNNG
KTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRATMKRTC
KCHGISGSCSIQTCWLQLAEFREMGDYLKAKYDQALKIEMDKRQLRAGNSAEGHWVPAEA
FLPSAEAELIFLEESPDYCTCNSSLGIYGTEGRECLQNSHNTSRWERRSCGRLCTECGLQ
VEERKTEVISSCNCKFQWCCTVKCDQCRHVVSKYYCARSPGSAQSLGKGSA

Sequence length

351

Interactions

View interactions

	KEGG		Reactome
	mTOR signaling pathway Wnt signaling pathway Hippo signaling pathway Signaling pathways regulating pluripotency of stem cells Melanogenesis Cushing syndrome Alzheimer disease Pathways of neurodegeneration - multiple diseases Human papillomavirus infection Pathways in cancer Proteoglycans in cancer Basal cell carcinoma Breast cancer Hepatocellular carcinoma Gastric cancer		WNT ligand biogenesis and trafficking Disassembly of the destruction complex and recruitment of AXIN to the membrane

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Atrial fibrillation	Atrial Fibrillation	rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557 View all (6 more)	22544366, 30061737

Show/Hide Unknown Diseases (4)

Disease term	Disease name	References	Source
Unknown
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	22544366	ClinVar
Atrial Fibrillation	Atrial Fibrillation		GWAS
Diabetes	Diabetes		GWAS
Alzheimer disease	Alzheimer disease		GWAS

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References
Associations from Text Mining
Hearing Loss	Associate	35322580
Neoplasms Germ Cell and Embryonal	Associate	35322580
Orofacial Cleft 1	Associate	18413325
Periapical Periodontitis	Associate	31831777
Tinnitus	Associate	35322580

WNT8A (Wnt family member 8A)