WNT6 (Wnt family member 6)

Gene

• Entrez ID: 7475
• Gene name: Wnt family member 6
• Gene symbol: WNT6
• Synonyms (NCBI Gene): -
• Chromosome: 2
• Chromosome location: 2q35
• Summary: The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021434	hsa-miR-9-5p	Microarray	17612493
MIRT736198	hsa-miR-378a-5p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	32829178

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005109	Function	Frizzled binding	IBA
GO:0005125	Function	Cytokine activity	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0009798	Process	Axis specification	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	20113781
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030182	Process	Neuron differentiation	ISS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0031012	Component	Extracellular matrix	IEA
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IMP	20113781
GO:0045165	Process	Cell fate commitment	IBA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060684	Process	Epithelial-mesenchymal cell signaling	IEA
GO:0061303	Process	Cornea development in camera-type eye	ISS	16258938
GO:0070062	Component	Extracellular exosome	TAS
GO:0070172	Process	Positive regulation of tooth mineralization	IMP	20113781
GO:0071300	Process	Cellular response to retinoic acid	ISS
GO:0072079	Process	Nephron tubule formation	IEA
GO:0072080	Process	Nephron tubule development	IEA

Other IDs

• MIM: 604663
• HGNC: 12785
• e!Ensembl: ENSG00000115596

Protein

• UniProt ID: Q9Y6F9
• Protein name: Protein Wnt-6
• Protein function: Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameter
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00110	wnt	43 → 365	wnt family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in gastric cancer cell lines and gastric cancer tissues (at protein level). Detected in the apical gland region of the gastric foveolar epithelium (at protein level). {ECO:0000269|PubMed:22370641}.
• Sequence:

  MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPE
  VVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAV
  TQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGD
  EKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKL
  PPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRT
  GSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKE
  LSLCL

• Sequence length: 365

Pathways

KEGG:

mTOR signaling pathway
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
Cushing syndrome
Alzheimer disease
Pathways of neurodegeneration - multiple diseases
Human papillomavirus infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Breast cancer
Hepatocellular carcinoma
Gastric cancer

Reactome:

WNT ligand biogenesis and trafficking

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder exstrophy-epispadias-cloacal extrophy complex	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenoma	Associate	21547848	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	23372744, 32572884	★☆☆☆☆ Found in Text Mining only
Dental Pulp Calcification	Associate	37566620	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Associate	26617869	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Associate	26617869	★☆☆☆☆ Found in Text Mining only
Gallbladder Diseases	Associate	26111189	★☆☆☆☆ Found in Text Mining only
Glucosephosphate Dehydrogenase Deficiency	Associate	26617869	★☆☆☆☆ Found in Text Mining only
Heterotaxy Syndrome	Associate	26111189	★☆☆☆☆ Found in Text Mining only
Hypoxia	Associate	30257451	★☆☆☆☆ Found in Text Mining only
Hypoxia Brain	Associate	30257451	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Associate	14973184	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	25048347	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Stimulate	30431574	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	26617869, 27548314, 30431574	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Stimulate	30431574	★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Associate	34642262	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	24495014	★☆☆☆☆ Found in Text Mining only