Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7475
Gene name	Wnt family member 6
Gene symbol	WNT6
Synonyms (NCBI Gene)	-
Chromosome	2
Chromosome location	2q35
Summary	The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog

Show/Hide all (2)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021434	hsa-miR-9-5p	Microarray	17612493
MIRT736198	hsa-miR-378a-5p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)qRT-PCR	32829178

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005109	Function	Frizzled binding	IBA
GO:0005125	Function	Cytokine activity	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0009798	Process	Axis specification	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	20113781
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030182	Process	Neuron differentiation	ISS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0031012	Component	Extracellular matrix	IEA
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IMP	20113781
GO:0045165	Process	Cell fate commitment	IBA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060684	Process	Epithelial-mesenchymal cell signaling	IEA
GO:0061303	Process	Cornea development in camera-type eye	ISS	16258938
GO:0070062	Component	Extracellular exosome	TAS
GO:0070172	Process	Positive regulation of tooth mineralization	IMP	20113781
GO:0071300	Process	Cellular response to retinoic acid	ISS
GO:0072079	Process	Nephron tubule formation	IEA
GO:0072080	Process	Nephron tubule development	IEA

MIM	HGNC	e!Ensembl
604663	12785	ENSG00000115596

Q9Y6F9

Protein name

Protein Wnt-6

Protein function

Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameter

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00110	wnt	43 → 365	wnt family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in gastric cancer cell lines and gastric cancer tissues (at protein level). Detected in the apical gland region of the gastric foveolar epithelium (at protein level). {ECO:0000269|PubMed:22370641}.

Sequence

MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPE
VVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAV
TQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGD
EKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKL
PPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRT
GSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKE
LSLCL

Sequence length

365

Interactions

View interactions

	KEGG		Reactome
	mTOR signaling pathway Wnt signaling pathway Hippo signaling pathway Signaling pathways regulating pluripotency of stem cells Melanogenesis Cushing syndrome Alzheimer disease Pathways of neurodegeneration - multiple diseases Human papillomavirus infection Pathways in cancer Proteoglycans in cancer Basal cell carcinoma Breast cancer Hepatocellular carcinoma Gastric cancer		WNT ligand biogenesis and trafficking

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Bladder exstrophy-epispadias-cloacal extrophy complex	Likely benign	rs786205888	RCV000172900

Show/Hide Text Mining Associations (17)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenoma	Associate	21547848
Breast Neoplasms	Associate	23372744, 32572884
Dental Pulp Calcification	Associate	37566620
Esophageal Neoplasms	Associate	26617869
Esophageal Squamous Cell Carcinoma	Associate	26617869
Gallbladder Diseases	Associate	26111189
Glucosephosphate Dehydrogenase Deficiency	Associate	26617869
Heterotaxy Syndrome	Associate	26111189
Hypoxia	Associate	30257451
Hypoxia Brain	Associate	30257451
Leukemia Lymphocytic Chronic B Cell	Associate	14973184
Neoplasm Metastasis	Associate	25048347
Neoplasm Metastasis	Stimulate	30431574
Neoplasms	Associate	26617869, 27548314, 30431574
Osteosarcoma	Stimulate	30431574
Rectal Neoplasms	Associate	34642262
Urinary Bladder Neoplasms	Associate	24495014

WNT6 (Wnt family member 6)