Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7471
Gene name	Wnt family member 1
Gene symbol	WNT1
Synonyms (NCBI Gene)	BMND16INT1OI15
Chromosome	12
Chromosome location	12q13.12
Summary	The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs387907358	G>T	Uncertain-significance, pathogenic	Missense variant, coding sequence variant

Show/Hide all (68)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001231	hsa-miR-34a-5p	Luciferase reporter assay	19336450
MIRT001231	hsa-miR-34a-5p	Luciferase reporter assay	19336450
MIRT001231	hsa-miR-34a-5p	Luciferase reporter assay	19336450
MIRT001231	hsa-miR-34a-5p	FlowImmunoblotLuciferase reporter assayMicroarrayqRT-PCR	19398721
MIRT005718	hsa-let-7e-5p	FlowImmunoblotLuciferase reporter assayMicroarrayqRT-PCR	19398721
MIRT006421	hsa-miR-122-5p	Luciferase reporter assayqRT-PCRWestern blot	22276989
MIRT006421	hsa-miR-122-5p	Luciferase reporter assayqRT-PCRWestern blot	22276989
MIRT006421	hsa-miR-122-5p	Luciferase reporter assayqRT-PCRWestern blot	22276989
MIRT006421	hsa-miR-122-5p	Luciferase reporter assayqRT-PCRWestern blot	22276989
MIRT006421	hsa-miR-122-5p	Luciferase reporter assayqRT-PCRWestern blot	22276989
MIRT006421	hsa-miR-122-5p	Luciferase reporter assayqRT-PCRWestern blot	22276989
MIRT053534	hsa-miR-22-3p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23851184
MIRT053534	hsa-miR-22-3p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23851184
MIRT053535	hsa-miR-200b-3p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23851184
MIRT053535	hsa-miR-200b-3p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23851184
MIRT054376	hsa-miR-152-3p	Luciferase reporter assayqRT-PCRWestern blot	24416131
MIRT732353	hsa-miR-148a-3p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	28199399
MIRT732353	hsa-miR-148a-3p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	28199399
MIRT732353	hsa-miR-148a-3p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	28199399
MIRT732353	hsa-miR-148a-3p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	28199399
MIRT732353	hsa-miR-148a-3p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	26707142
MIRT732353	hsa-miR-148a-3p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	26707142
MIRT006421	hsa-miR-122-5p	Luciferase reporter assayqRT-PCR	27687586
MIRT001231	hsa-miR-34a-5p	Luciferase reporter assayqRT-PCRWestern blot	28199987
MIRT733878	hsa-miR-762	Western blotting	34092606
MIRT733927	mmu-miR-762	Western blotting	34092606
MIRT1493579	hsa-let-7a	CLIP-seq
MIRT1493580	hsa-let-7b	CLIP-seq
MIRT1493581	hsa-let-7c	CLIP-seq
MIRT1493582	hsa-let-7d	CLIP-seq
MIRT1493583	hsa-let-7e	CLIP-seq
MIRT1493584	hsa-let-7f	CLIP-seq
MIRT1493585	hsa-let-7g	CLIP-seq
MIRT1493586	hsa-let-7i	CLIP-seq
MIRT1493587	hsa-miR-1207-5p	CLIP-seq
MIRT1493588	hsa-miR-1321	CLIP-seq
MIRT1493589	hsa-miR-1471	CLIP-seq
MIRT1493590	hsa-miR-1915	CLIP-seq
MIRT1493591	hsa-miR-24	CLIP-seq
MIRT1493592	hsa-miR-3202	CLIP-seq
MIRT1493593	hsa-miR-3612	CLIP-seq
MIRT1493594	hsa-miR-3622b-5p	CLIP-seq
MIRT1493595	hsa-miR-4270	CLIP-seq
MIRT1493596	hsa-miR-4284	CLIP-seq
MIRT1493597	hsa-miR-4419a	CLIP-seq
MIRT1493598	hsa-miR-4441	CLIP-seq
MIRT1493599	hsa-miR-4458	CLIP-seq
MIRT1493600	hsa-miR-4475	CLIP-seq
MIRT1493601	hsa-miR-4476	CLIP-seq
MIRT1493602	hsa-miR-4500	CLIP-seq
MIRT1493603	hsa-miR-4510	CLIP-seq
MIRT1493604	hsa-miR-4722-5p	CLIP-seq
MIRT1493605	hsa-miR-4728-5p	CLIP-seq
MIRT1493606	hsa-miR-4736	CLIP-seq
MIRT1493607	hsa-miR-4739	CLIP-seq
MIRT1493608	hsa-miR-4756-5p	CLIP-seq
MIRT1493609	hsa-miR-4763-3p	CLIP-seq
MIRT1493610	hsa-miR-4768-3p	CLIP-seq
MIRT1493611	hsa-miR-650	CLIP-seq
MIRT1493612	hsa-miR-98	CLIP-seq
MIRT2148783	hsa-miR-4689	CLIP-seq
MIRT2369172	hsa-miR-151-5p	CLIP-seq
MIRT2369173	hsa-miR-151b	CLIP-seq
MIRT2369174	hsa-miR-1827	CLIP-seq
MIRT2369175	hsa-miR-3150b-3p	CLIP-seq
MIRT2148783	hsa-miR-4689	CLIP-seq
MIRT2369176	hsa-miR-4695-5p	CLIP-seq
MIRT2369177	hsa-miR-4784	CLIP-seq

101

Show/Hide all (101)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000578	Process	Embryonic axis specification	IEA
GO:0000578	Process	Embryonic axis specification	ISS
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005109	Function	Frizzled binding	IBA
GO:0005109	Function	Frizzled binding	IC	19756656
GO:0005109	Function	Frizzled binding	NAS	23461676
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	11357136
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	ISS
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	IDA	11793365, 19756656
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0007267	Process	Cell-cell signaling	IEA
GO:0007267	Process	Cell-cell signaling	ISS
GO:0007520	Process	Myoblast fusion	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	16501043
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	19778454
GO:0009611	Process	Response to wounding	IEP	17982423
GO:0009986	Component	Cell surface	IEA
GO:0010592	Process	Positive regulation of lamellipodium assembly	IMP	19756656
GO:0010812	Process	Negative regulation of cell-substrate adhesion	IDA	16501043
GO:0014902	Process	Myotube differentiation	IEA
GO:0016015	Function	Morphogen activity	TAS	24431302
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	ISS	9192640
GO:0019904	Function	Protein domain specific binding	IEA
GO:0021527	Process	Spinal cord association neuron differentiation	IEA
GO:0021536	Process	Diencephalon development	IEA
GO:0021549	Process	Cerebellum development	IEA
GO:0021551	Process	Central nervous system morphogenesis	IEA
GO:0021551	Process	Central nervous system morphogenesis	ISS
GO:0021588	Process	Cerebellum formation	IEA
GO:0021588	Process	Cerebellum formation	ISS
GO:0021797	Process	Forebrain anterior/posterior pattern specification	IEA
GO:0022004	Process	Midbrain-hindbrain boundary maturation during brain development	IEA
GO:0022008	Process	Neurogenesis	IEA
GO:0022037	Process	Metencephalon development	IEA
GO:0022408	Process	Negative regulation of cell-cell adhesion	IMP	17072303
GO:0030182	Process	Neuron differentiation	IBA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0030514	Process	Negative regulation of BMP signaling pathway	IMP	16194878
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030901	Process	Midbrain development	IEA
GO:0030901	Process	Midbrain development	ISS
GO:0030917	Process	Midbrain-hindbrain boundary development	IEA
GO:0031100	Process	Animal organ regeneration	IEA
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0033278	Process	Cell proliferation in midbrain	IEA
GO:0036520	Process	Astrocyte-dopaminergic neuron signaling	IEA
GO:0042472	Process	Inner ear morphogenesis	IEA
GO:0042770	Process	Signal transduction in response to DNA damage	IDA	16501043
GO:0043066	Process	Negative regulation of apoptotic process	IMP	12154096
GO:0043568	Process	Positive regulation of insulin-like growth factor receptor signaling pathway	IDA	12154096
GO:0045165	Process	Cell fate commitment	IBA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045596	Process	Negative regulation of cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	ISS
GO:0045747	Process	Positive regulation of Notch signaling pathway	IDA	16501043
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	10644691
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	19847889
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048018	Function	Receptor ligand activity	IC	19778454
GO:0048018	Function	Receptor ligand activity	IDA	28733458
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048018	Function	Receptor ligand activity	NAS	23461676
GO:0048146	Process	Positive regulation of fibroblast proliferation	IMP	19734317
GO:0048663	Process	Neuron fate commitment	IEA
GO:0048664	Process	Neuron fate determination	IEA
GO:0060061	Process	Spemann organizer formation	IEA
GO:0060061	Process	Spemann organizer formation	ISS
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	10644691, 28733458
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IMP	12154096, 19756656, 19778454
GO:0060070	Process	Canonical Wnt signaling pathway	NAS	23461676
GO:0060070	Process	Canonical Wnt signaling pathway	TAS	22988876, 24431302, 26049140
GO:0060348	Process	Bone development	IMP	23499309
GO:0061184	Process	Positive regulation of dermatome development	IDA	10654605
GO:0070062	Component	Extracellular exosome	TAS
GO:0070365	Process	Hepatocyte differentiation	IEA
GO:0071375	Process	Cellular response to peptide hormone stimulus	IEA
GO:0071425	Process	Hematopoietic stem cell proliferation	IEA
GO:0071542	Process	Dopaminergic neuron differentiation	IEA
GO:1902035	Process	Positive regulation of hematopoietic stem cell proliferation	IEA
GO:1903377	Process	Negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IEA
GO:1904948	Process	Midbrain dopaminergic neuron differentiation	IEA
GO:1904948	Process	Midbrain dopaminergic neuron differentiation	NAS	23461676
GO:1904948	Process	Midbrain dopaminergic neuron differentiation	TAS	22988876
GO:1990403	Process	Embryonic brain development	IEA
GO:2000059	Process	Negative regulation of ubiquitin-dependent protein catabolic process	IEA
GO:2000773	Process	Negative regulation of cellular senescence	IDA	16501043

MIM	HGNC	e!Ensembl
164820	12774	ENSG00000125084

P04628

Protein name

Proto-oncogene Wnt-1 (Proto-oncogene Int-1 homolog)

Protein function

Ligand for members of the frizzled family of seven transmembrane receptors (Probable). Acts in the canonical Wnt signaling pathway by promoting beta-catenin-dependent transcriptional activation (PubMed:23499309, PubMed:23656646, PubMed:26902720,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00110	wnt	60 → 370	wnt family	Family

Sequence

MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL

Sequence length

370

Interactions

View interactions

Show/Hide Causal Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Osteogenesis imperfecta	Pathogenic	rs779969402	RCV002271673
Osteogenesis imperfecta type 15	Likely pathogenic; Pathogenic	rs2137624585, rs779969402, rs2137625115, rs2137625424, rs2137625459, rs727505392, rs2498946534, rs778294620, rs1555178899, rs387907353, rs387907354, rs387907355, rs387907356, rs387907357	RCV001729995 RCV001806348 RCV005006132 RCV002244150 RCV002251300 RCV000157063 RCV003134801 RCV003139442 RCV000677241 RCV000043491 RCV000043493 RCV000043494 RCV000043495 RCV000043496
OSTEOPOROSIS, EARLY-ONSET, SUSCEPTIBILITY TO	Likely pathogenic; Pathogenic	rs2137625115, rs387907353, rs387907356	RCV005006132 RCV000043492 RCV005007964
See cases	Pathogenic	rs2498947383	RCV004584491
WNT1-related disorder	Likely pathogenic	rs750005846	RCV003422478

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Connective tissue disorder	Uncertain significance	rs1324762785	RCV002278843
Gastric cancer	Uncertain significance	rs201861196	RCV005925574
Keratoconus	Conflicting classifications of pathogenicity	rs387907358	RCV000678662
Osteogenesis imperfecta type III	Conflicting classifications of pathogenicity	rs1592257435	RCV000860011

Show/Hide Text Mining Associations (87)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	18399550
Adenoma Pleomorphic	Associate	25076852
Adrenal Cortex Neoplasms	Associate	32522271
Amyotrophic Lateral Sclerosis	Inhibit	25811776
Arthritis Rheumatoid	Associate	10688908, 12428226
Arthropathy progressive pseudorheumatoid of childhood	Associate	29246200
Autism Spectrum Disorder	Associate	24002087
Bone Diseases	Associate	27005318, 30447692
Bone Diseases Metabolic	Associate	31968132, 33716164
Brain Diseases	Associate	30012084
Breast Neoplasms	Associate	17074804, 17897439, 18059186, 22270359, 23372744, 26421711, 27036017, 32329856
Calcinosis Cutis	Associate	15316903
Carcinogenesis	Associate	15736421, 2515180, 36056132, 9601641
Carcinoma Hepatocellular	Associate	31322232, 31599410, 36619232
Carcinoma Non Small Cell Lung	Associate	21336184, 27534621, 28199399, 34666560
Carcinoma Ovarian Epithelial	Associate	24499657
Carcinoma Renal Cell	Associate	23708097
Carcinoma Squamous Cell	Associate	27420949
Carcinoma Squamous Cell	Inhibit	34666560
Cartilage Diseases	Associate	31299386
Central Nervous System Vascular Malformations	Associate	32529806
Chorea Gravidarum	Associate	33716164
Chronic Disease	Associate	34220309
Colorectal Neoplasms	Associate	21678109, 30015876
Coronary Artery Disease	Associate	38139440
Crohn Disease	Associate	26512113
Cytokine Release Syndrome	Associate	34220309
Depressive Disorder	Associate	30246918
Endometrial Neoplasms	Associate	37176048
Endometriosis	Associate	24661731
Esophageal Squamous Cell Carcinoma	Associate	20491588
Exotropia	Associate	32529806
Fetal Growth Retardation	Associate	31415216
Fractures Bone	Associate	31968132, 40282376
Fragile X Syndrome	Associate	30447692, 36595228
Gallbladder Diseases	Associate	26111189
Hamartoma	Inhibit	21909471
HEM dysplasia	Associate	29246200
Hematologic Diseases	Associate	36595228
Hemimegalencephaly	Associate	16196383
Heterotaxy Syndrome	Associate	26111189
Hirschsprung Disease	Associate	24773279
Hypoxia	Stimulate	24301659
Hypoxia	Associate	26515145
Idiopathic Pulmonary Fibrosis	Stimulate	18478089
Infections	Inhibit	32121148
Inflammation	Associate	37914154
Inflammatory Bowel Diseases	Associate	24301659
Inflammatory Breast Neoplasms	Associate	20503407
Kallmann Syndrome	Associate	32529806
Liposarcoma Myxoid	Associate	2515180
Lung Neoplasms	Associate	28231299, 30756509, 32633368
Lymphatic Metastasis	Associate	15316903
Lymphatic Metastasis	Stimulate	20491588
Lymphoma Follicular	Associate	37176048
Macrophage Activation Syndrome	Associate	24301659
Mood Disorders	Associate	24002087
Musculoskeletal Abnormalities	Associate	30447692
Nasopharyngeal Carcinoma	Associate	19448422
Neoplasm Metastasis	Associate	15316903, 24713700
Neoplasms	Associate	15068666, 15316903, 16756720, 18399550, 19448422, 24373193, 24713700, 25076852, 34666560, 36056132, 37176048
Neoplasms Adipose Tissue	Associate	28379384
Nerve Degeneration	Inhibit	21374761
Nerve Degeneration	Associate	22388478
Odontoma	Associate	38133085
Osteochondrodysplasias	Associate	23499310
Osteogenesis Imperfecta	Associate	23499310, 30012084, 30246918, 30447692, 32529806, 32757296, 34078411, 35647203, 36595228, 37730650
Osteogenesis imperfecta type 3	Associate	23499310
Osteogenesis Imperfecta Type IV	Associate	35550181
Osteoporosis	Associate	27005318, 28379384, 30246918, 31299386, 31968132, 32080087, 35276006, 36004351, 36157448, 36595228, 37277619
Osteoporosis pseudoglioma syndrome	Associate	23499310, 30012084, 36004351
Osteosarcoma	Associate	24942472, 25197350
Ovarian Neoplasms	Associate	24499657, 34002485
Parkinson Disease	Associate	31582965
Pituitary Neoplasms	Associate	36595228
Placenta Diseases	Associate	34220309
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	34039781
Prostatic Neoplasms	Associate	24659666, 28510291, 35741800
Prostatitis	Associate	15316903
Ptosis Hereditary Congenital 2	Associate	32529806
Rectal Neoplasms	Associate	16397240
Sarcoma	Associate	15913453
Sjogren's Syndrome	Associate	34058801
Stomach Neoplasms	Associate	31599413, 35287556, 36056132
Strabismus	Associate	30246918
Travel Related Illness	Associate	37277619
Tuberous Sclerosis	Associate	36595228

WNT1 (Wnt family member 1)