Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7466
Gene name Gene Name - the full gene name approved by the HGNC.	Wolframin ER transmembrane glycoprotein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	WFS1
Synonyms (NCBI Gene) Gene synonyms aliases	CTRCT41, WFRS, WFS, WFSL
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4p16.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a transmembrane protein, which is located primarily in the endoplasmic reticulum and ubiquitously expressed with highest levels in brain, pancreas, heart, and insulinoma beta-cell lines. Mutations in this gene are associated with Wolfram

Show/Hide all(92)

SNP ID	Visualize variation	Clinical significance	Consequence
rs6446482	C>A,G	Conflicting-interpretations-of-pathogenicity, benign	Intron variant
rs10010131	A>G	Benign, pathogenic	Intron variant
rs28937890	C>T	Pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs28937891	G>A,T	Pathogenic	Missense variant, coding sequence variant
rs28937892	C>A,T	Pathogenic	Missense variant, coding sequence variant
rs28937893	G>A,C	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs28937894	C>T	Pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs28937895	G>A,C	Pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs35932623	C>T	Likely-benign, uncertain-significance, benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs55814513	G>A,T	Likely-benign, benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs56002719	A>T	Likely-benign, benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs56035336	C>T	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs61735401	C>T	Benign-likely-benign, conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs71524353	G>A,T	Likely-benign, conflicting-interpretations-of-pathogenicity	Stop gained, missense variant, coding sequence variant
rs71524377	G>A,T	Likely-benign, pathogenic	Missense variant, coding sequence variant
rs71524381	C>G,T	Likely-benign, conflicting-interpretations-of-pathogenicity	Synonymous variant, missense variant, coding sequence variant
rs71526461	T>C	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs71530923	C>G,T	Likely-pathogenic, pathogenic, not-provided	Stop gained, missense variant, coding sequence variant
rs71532863	G>A,T	Likely-pathogenic	Stop gained, missense variant, coding sequence variant
rs71539657	G>A	Likely-benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs71539668	G>A,T	Benign-likely-benign, conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs71539673	G>A	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs104893879	G>A,C	Pathogenic	Stop gained, missense variant, coding sequence variant
rs104893880	C>T	Pathogenic	Stop gained, coding sequence variant
rs104893881	C>G,T	Pathogenic	Stop gained, missense variant, coding sequence variant
rs104893882	A>C,G	Pathogenic	Missense variant, coding sequence variant
rs104893883	T>C	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs112871383	C>A,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Missense variant, coding sequence variant
rs121912618	G>A,T	Pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs138232538	G>A,C	Conflicting-interpretations-of-pathogenicity, benign-likely-benign, uncertain-significance	Missense variant, coding sequence variant
rs140115060	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, synonymous variant
rs141177727	C>G,T	Likely-benign, conflicting-interpretations-of-pathogenicity	Synonymous variant, missense variant, coding sequence variant
rs141585847	T>G	Likely-pathogenic	Missense variant, coding sequence variant
rs142668478	G>A,C,T	Uncertain-significance, pathogenic	Missense variant, coding sequence variant
rs143064649	G>A	Pathogenic	Stop gained, coding sequence variant
rs144840779	A>C	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs145639028	G>A	Pathogenic	Missense variant, coding sequence variant
rs146132083	C>G,T	Likely-benign, uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs146670741	G>A	Uncertain-significance, likely-pathogenic	Missense variant, coding sequence variant
rs147834269	G>A	Likely-benign, conflicting-interpretations-of-pathogenicity, benign-likely-benign	Missense variant, coding sequence variant
rs149013740	G>A,C	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs149846741	C>T	Likely-benign, conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs199910987	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs199946797	C>A,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs200672755	G>A,C	Likely-pathogenic, pathogenic-likely-pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs201239579	G>T	Pathogenic	Coding sequence variant, stop gained
rs369107336	C>A,G,T	Pathogenic, uncertain-significance, likely-benign	Coding sequence variant, stop gained, missense variant
rs377539343	C>T	Likely-benign, conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs387906930	C>G,T	Pathogenic	Coding sequence variant, missense variant
rs387906931	G>A	Pathogenic	Coding sequence variant, missense variant
rs397517196	A>C	Pathogenic	Coding sequence variant, missense variant
rs397517197	ACG>-,ACGACG	Benign-likely-benign, conflicting-interpretations-of-pathogenicity	Coding sequence variant, inframe insertion, inframe deletion
rs398123066	A>G	Pathogenic	Coding sequence variant, missense variant
rs727503745	->CTGAAGG	Pathogenic	Frameshift variant, coding sequence variant
rs752461187	AAG>-,AAGAAG	Likely-pathogenic	Inframe deletion, coding sequence variant, inframe insertion
rs753237278	G>A,C	Likely-pathogenic	Missense variant, coding sequence variant
rs760171298	G>A,C,T	Likely-pathogenic	Coding sequence variant, missense variant, stop gained
rs760337383	CTCT>-,CT	Pathogenic	Coding sequence variant, frameshift variant
rs760631912	C>A,T	Likely-pathogenic	Coding sequence variant, missense variant
rs760938537	G>A,C	Likely-pathogenic	Coding sequence variant, missense variant, synonymous variant
rs771409809	C>T	Pathogenic	Coding sequence variant, stop gained
rs772392224	G>A	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs773312242	C>A,T	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, synonymous variant
rs774265764	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs777580652	C>G,T	Pathogenic	Stop gained, coding sequence variant, synonymous variant
rs777663097	C>T	Pathogenic	Coding sequence variant, missense variant
rs781575919	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs797045075	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs797046112	TTC>-	Likely-pathogenic	Coding sequence variant, inframe deletion
rs797046113	CCTCTT>-	Likely-pathogenic	Coding sequence variant, inframe deletion
rs863224264	->TTGA	Uncertain-significance, likely-pathogenic	Stop gained, coding sequence variant, inframe insertion
rs863224265	GTC>-	Pathogenic	Coding sequence variant, inframe deletion
rs863224266	CG>TA	Likely-pathogenic	Coding sequence variant, missense variant
rs876657675	G>C	Likely-pathogenic	Coding sequence variant, missense variant
rs876657735	TTC>-	Pathogenic	Coding sequence variant, inframe deletion
rs886044563	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1064796781	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs1064797306	CGAG>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1131691259	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1131691778	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1191510461	G>A	Pathogenic	Splice donor variant
rs1281745640	G>A,T	Likely-pathogenic	Splice donor variant
rs1362648752	->GGCCGTCGCGAGGCTG	Pathogenic	Frameshift variant, coding sequence variant
rs1430938532	C>G,T	Likely-pathogenic	Missense variant, coding sequence variant, stop gained
rs1443751733	T>G	Pathogenic	Stop gained, coding sequence variant
rs1553876668	C>A	Pathogenic	Stop gained, coding sequence variant
rs1553879004	G>A	Pathogenic	Coding sequence variant, missense variant
rs1560408865	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs1560418164	TCT>-	Likely-pathogenic	Inframe deletion, coding sequence variant
rs1578609780	AGGTCACCG>-	Pathogenic	Inframe deletion, coding sequence variant
rs1578611240	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs1578612324	->T	Pathogenic	Coding sequence variant, frameshift variant

Show/Hide all(75)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000164	hsa-miR-21-5p	Quantitative proteomic approach	19253296
MIRT025906	hsa-miR-7-5p	Microarray	19073608
MIRT1492376	hsa-miR-1246	CLIP-seq
MIRT1492377	hsa-miR-2110	CLIP-seq
MIRT1492378	hsa-miR-31	CLIP-seq
MIRT1492379	hsa-miR-3134	CLIP-seq
MIRT1492380	hsa-miR-3937	CLIP-seq
MIRT1492381	hsa-miR-3944-3p	CLIP-seq
MIRT1492382	hsa-miR-4269	CLIP-seq
MIRT1492383	hsa-miR-4271	CLIP-seq
MIRT1492384	hsa-miR-4320	CLIP-seq
MIRT1492385	hsa-miR-4492	CLIP-seq
MIRT1492386	hsa-miR-4498	CLIP-seq
MIRT1492387	hsa-miR-4505	CLIP-seq
MIRT1492388	hsa-miR-4514	CLIP-seq
MIRT1492389	hsa-miR-4534	CLIP-seq
MIRT1492390	hsa-miR-4667-5p	CLIP-seq
MIRT1492391	hsa-miR-4692	CLIP-seq
MIRT1492392	hsa-miR-4696	CLIP-seq
MIRT1492393	hsa-miR-4700-5p	CLIP-seq
MIRT1492394	hsa-miR-4725-3p	CLIP-seq
MIRT1492395	hsa-miR-4731-5p	CLIP-seq
MIRT1492396	hsa-miR-4742-5p	CLIP-seq
MIRT1492397	hsa-miR-548q	CLIP-seq
MIRT1492398	hsa-miR-762	CLIP-seq
MIRT1492399	hsa-miR-3689d	CLIP-seq
MIRT1492400	hsa-miR-3941	CLIP-seq
MIRT1492401	hsa-miR-4318	CLIP-seq
MIRT1492402	hsa-miR-466	CLIP-seq
MIRT1492403	hsa-miR-4672	CLIP-seq
MIRT1492404	hsa-miR-4693-5p	CLIP-seq
MIRT1492405	hsa-miR-583	CLIP-seq
MIRT1492406	hsa-miR-892a	CLIP-seq
MIRT1555595	hsa-miR-361-3p	CLIP-seq
MIRT2148465	hsa-miR-1287	CLIP-seq
MIRT2148466	hsa-miR-1827	CLIP-seq
MIRT2148467	hsa-miR-3135b	CLIP-seq
MIRT2148468	hsa-miR-370	CLIP-seq
MIRT2148469	hsa-miR-4301	CLIP-seq
MIRT2148470	hsa-miR-4459	CLIP-seq
MIRT2148471	hsa-miR-4520a-3p	CLIP-seq
MIRT2148472	hsa-miR-4638-3p	CLIP-seq
MIRT2148473	hsa-miR-4779	CLIP-seq
MIRT2368890	hsa-miR-106a	CLIP-seq
MIRT2368891	hsa-miR-106b	CLIP-seq
MIRT2368892	hsa-miR-17	CLIP-seq
MIRT2368893	hsa-miR-20a	CLIP-seq
MIRT2368894	hsa-miR-20b	CLIP-seq
MIRT2368895	hsa-miR-216a	CLIP-seq
MIRT2368896	hsa-miR-302a	CLIP-seq
MIRT2368897	hsa-miR-302b	CLIP-seq
MIRT2368898	hsa-miR-302c	CLIP-seq
MIRT2368899	hsa-miR-302d	CLIP-seq
MIRT2368900	hsa-miR-302e	CLIP-seq
MIRT2368901	hsa-miR-3140-3p	CLIP-seq
MIRT2368902	hsa-miR-3180-5p	CLIP-seq
MIRT2368903	hsa-miR-3607-3p	CLIP-seq
MIRT2368904	hsa-miR-3609	CLIP-seq
MIRT2368905	hsa-miR-3686	CLIP-seq
MIRT2368906	hsa-miR-372	CLIP-seq
MIRT2368907	hsa-miR-373	CLIP-seq
MIRT2368908	hsa-miR-4796-3p	CLIP-seq
MIRT2368909	hsa-miR-519d	CLIP-seq
MIRT2368910	hsa-miR-520a-3p	CLIP-seq
MIRT2368911	hsa-miR-520a-5p	CLIP-seq
MIRT2368912	hsa-miR-520b	CLIP-seq
MIRT2368913	hsa-miR-520c-3p	CLIP-seq
MIRT2368914	hsa-miR-520d-3p	CLIP-seq
MIRT2368915	hsa-miR-520e	CLIP-seq
MIRT2368916	hsa-miR-520f	CLIP-seq
MIRT2368917	hsa-miR-525-5p	CLIP-seq
MIRT2368918	hsa-miR-548ah	CLIP-seq
MIRT2368919	hsa-miR-93	CLIP-seq
MIRT2695233	hsa-miR-3974	CLIP-seq
MIRT2695234	hsa-miR-668	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
XBP1	Unknown	16539657

Show/Hide all(76)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	20160352
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0001822	Process	Kidney development	IMP	9817917
GO:0003091	Process	Renal water homeostasis	IMP	9817917
GO:0005515	Function	Protein binding	IPI	17947299, 21044950, 23035048, 25274773, 32296183, 32814053
GO:0005516	Function	Calmodulin binding	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	23035048
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	11181571, 14527944
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	NAS	20160352
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006983	Process	ER overload response	IDA	16989814
GO:0006983	Process	ER overload response	TAS	17947299
GO:0007601	Process	Visual perception	IMP	9771706, 9817917
GO:0007605	Process	Sensory perception of sound	IMP	17492394
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010558	Process	Negative regulation of macromolecule biosynthetic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0017148	Process	Negative regulation of translation	IEA
GO:0030133	Component	Transport vesicle	IEA
GO:0030141	Component	Secretory granule	IDA	23035048
GO:0030425	Component	Dendrite	ISS	11181571
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IBA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IEA
GO:0031016	Process	Pancreas development	IEA
GO:0031398	Process	Positive regulation of protein ubiquitination	IDA	20160352
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0031398	Process	Positive regulation of protein ubiquitination	ISS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IDA	20160352
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0032469	Process	Endoplasmic reticulum calcium ion homeostasis	IDA	16989814
GO:0034976	Process	Response to endoplasmic reticulum stress	IDA	15994758
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0036503	Process	ERAD pathway	IDA	20160352
GO:0036503	Process	ERAD pathway	IEA
GO:0036503	Process	ERAD pathway	ISS
GO:0042048	Process	Olfactory behavior	IEA
GO:0042593	Process	Glucose homeostasis	IMP	9817917
GO:0043066	Process	Negative regulation of apoptotic process	IMP	23035048
GO:0043069	Process	Negative regulation of programmed cell death	IMP	9771706
GO:0043524	Process	Negative regulation of neuron apoptotic process	IMP	9771706, 9817917
GO:0045927	Process	Positive regulation of growth	IEA
GO:0045927	Process	Positive regulation of growth	ISS
GO:0048306	Function	Calcium-dependent protein binding	IEA
GO:0050821	Process	Protein stabilization	IDA	20160352
GO:0050821	Process	Protein stabilization	IEA
GO:0050821	Process	Protein stabilization	IMP	23035048
GO:0050821	Process	Protein stabilization	ISS
GO:0050821	Process	Protein stabilization	TAS	23710284
GO:0050877	Process	Nervous system process	IMP	9817917
GO:0051117	Function	ATPase binding	IEA
GO:0051117	Function	ATPase binding	IPI	17947299
GO:0051247	Process	Positive regulation of protein metabolic process	IDA	17947299
GO:0051928	Process	Positive regulation of calcium ion transport	IDA	16989814
GO:0055074	Process	Calcium ion homeostasis	IBA
GO:0055074	Process	Calcium ion homeostasis	IDA	14527944
GO:0055074	Process	Calcium ion homeostasis	IEA
GO:0070628	Function	Proteasome binding	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:0140597	Function	Protein carrier chaperone	IDA	20160352
GO:1902236	Process	Negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IEA
GO:1902532	Process	Negative regulation of intracellular signal transduction	IEA
GO:1903573	Process	Negative regulation of response to endoplasmic reticulum stress	IEA
GO:1903573	Process	Negative regulation of response to endoplasmic reticulum stress	IMP	23035048
GO:1903892	Process	Negative regulation of ATF6-mediated unfolded protein response	IDA	20160352
GO:1903892	Process	Negative regulation of ATF6-mediated unfolded protein response	IEA
GO:1904294	Process	Positive regulation of ERAD pathway	IEA
GO:2000675	Process	Negative regulation of type B pancreatic cell apoptotic process	IEA
GO:2000675	Process	Negative regulation of type B pancreatic cell apoptotic process	IMP	16087305

MIM	HGNC	e!Ensembl
606201	12762	ENSG00000109501

Protein

UniProt ID

O76024

Protein name

Wolframin

Protein function

Participates in the regulation of cellular Ca(2+) homeostasis, at least partly, by modulating the filling state of the endoplasmic reticulum Ca(2+) store (PubMed:16989814). Negatively regulates the ER stress response and positively regulates the

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in heart followed by brain, placenta, lung and pancreas. Weakly expressed in liver, kidney and skeletal muscle. Also expressed in islet and beta-cell insulinoma cell line.

Sequence

MDSNTAPLGPSCPQPPPAPQPQARSRLNATASLEQERSERPRAPGPQAGPGPGVRDAAAP
AEPQAQHTRSRERADGTGPTKGDMEIPFEEVLERAKAGDPKAQTEVGKHYLQLAGDTDEE
LNSCTAVDWLVLAAKQGRREAVKLLRRCLADRRGITSENEREVRQLSSETDLERAVRKAA
LVMYWKLNPKKKKQVAVAELLENVGQVNEHDGGAQPGPVPKSLQKQRRMLERLVSSESKN
YIALDDFVEITKKYAKGVIPSSLFLQDDEDDDELAGKSPEDLPLRLKVVKYPLHAIMEIK
EYLIDMASRAGMHWLSTIIPTHHINALIFFFIVSNLTIDFFAFFIPLVIFYLSFISMVIC
TLKVFQDSKAWENFRTLTDLLLRFEPNLDVEQAEVNFGWNHLEPYAHFLLSVFFVIFSFP
IASKDCIPCSELAVITGFFTVTSYLSLSTHAEPYTRRALATEVTAGLLSLLPSMPLNWPY
LKVLGQTFITVPVGHLVVLNVSVPCLLYVYLLYLFFRMAQLRNFKGTYCYLVPYLVCFMW
CELSVVILLESTGLGLLRASIGYFLFLFALPILVAGLALVGVLQFARWFTSLELTKIAVT
VAVCSVPLLLRWWTKASFSVVGMVKSLTRSSMVKLILVWLTAIVLFCWFYVYRSEGMKVY
NSTLTWQQYGALCGPRAWKETNMARTQILCSHLEGHRVTWTGRFKYVRVTDIDNSAESAI
NMLPFFIGDWMRCLYGEAYPACSPGNTSTAEEELCRLKLLAKHPCHIKKFDRYKFEITVG
MPFSSGADGSRSREEDDVTKDIVLRASSEFKSVLLSLRQGSLIEFSTILEGRLGSKWPVF
ELKAISCLNCMAQLSPTRRHVKIEHDWRSTVHGAVKFAFDFFFFPFLSAA

Sequence length

890

Interactions

View interactions

	KEGG		Reactome
	Protein processing in endoplasmic reticulum		XBP1(S) activates chaperone genes Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) Post-translational protein phosphorylation

Show/Hide Causal Diseases (7)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Cataract	cataract 41	rs398123066	N/A
Deafness	Autosomal dominant nonsyndromic hearing loss, Autosomal dominant nonsyndromic hearing loss 6	rs387906930, rs104893882, rs1131691778, rs74315205, rs372855769, rs28937893, rs104893883	N/A
Diabetes Mellitus	diabetes mellitus, Type 2 diabetes mellitus	rs143064649, rs199946797, rs1362648752, rs1553876668	N/A
Optic Atrophy	optic atrophy	rs760337383, rs1560408865, rs145639028, rs1057368575, rs1064794257, rs774265764, rs199946797	N/A
retinal dystrophy	Retinal dystrophy	rs74315205, rs1362648752, rs199946797	N/A
Wolfram Syndrome	wolfram syndrome 1, wolfram syndrome	rs1560408865, rs777580652, rs1578609780, rs1191510461, rs797046112, rs145639028, rs760171298, rs727503745, rs104893880, rs1443751733, rs797046113, rs372855769, rs71530923, rs104893881, rs1578612324 View all (23 more)	N/A
Wolfram-Like Syndrome	wolfram-like syndrome	rs74315205, rs372855769, rs201239579, rs387906930, rs71539673, rs876657675	N/A

Show/Hide Unknown Diseases (9)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Autism	autistic behavior	N/A	N/A	ClinVar
Diabetes	Mild age-related type 2 diabetes, Type 2 diabetes with neurological manifestations (PheCode 250.24), Type 2 diabetes with renal manifestations (PheCode 250.22), Type 2 diabetes with ophthalmic manifestations (PheCode 250.23), Type 2 diabetes (PheCode 250.2), Diabetes, Youth-onset type 2 diabetes, Type 2 diabetes, Type 2 diabetes (adjusted for BMI)	N/A	N/A	GWAS
hearing impairment	Hearing impairment	N/A	N/A	ClinVar
Heart Failure	Heart failure	N/A	N/A	GWAS
Meniere Disease	meniere disease	N/A	N/A	ClinVar
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Monogenic Diabetes	monogenic diabetes	N/A	N/A	ClinVar
Nonsyndromic Deafness	Nonsyndromic Hearing Loss, Dominant	N/A	N/A	ClinVar
Spastic Ataxia	spastic ataxia	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (101)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
18 Hydroxylase deficiency	Associate	36384999
6q24 Related Transient Neonatal Diabetes Mellitus	Associate	28468959
Alstrom Syndrome	Associate	28432734
Attention Deficit and Disruptive Behavior Disorders	Associate	37399203
Auditory neuropathy	Associate	39422244
Autoimmune Diseases	Associate	18688868
Bipolar Disorder	Associate	15473915
Blindness	Associate	34006618, 36933359
Cakut	Associate	27151922
Cardiomyopathy Dilated	Associate	36967753
Cataract	Associate	21623591, 23531866, 28432734, 28468959, 34014271, 36781206, 37493686, 39766859
Cataract Autosomal Dominant Nuclear	Associate	23531866
Color Vision Defects	Associate	39363032
Colorectal Neoplasms	Associate	31724326, 35395711, 36445321
Congenital Hemidysplasia with Ichthyosiform Erythroderma and Limb Defects	Associate	39609996
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	36967753
Costeff optic atrophy syndrome	Associate	34006618
COVID 19	Associate	37834358
Crohn Disease	Associate	18688868, 37493686
Deafness	Associate	18060660, 18688868, 19258739, 20069065, 21623591, 21713316, 22238590, 25289672, 28039263, 30682115, 34325055, 34630320, 36597107, 36933359
Deafness Autosomal Dominant 1	Associate	12490066, 16648378, 17517145, 18518985, 18688868, 29258540, 34258273, 36225977, 36833385, 39766859
Deafness Autosomal Dominant 6	Associate	18688868, 36833385, 39422244
Deafness X Linked 1	Associate	28468959
Death	Associate	22792385
Dementia	Associate	37834358
Depressive Disorder Major	Associate	15473915
Diabetes Insipidus	Associate	18060660, 19258739, 21713316, 22238590, 23429432, 29549887, 32938580, 37399203
Diabetes Mellitus	Associate	12707373, 16442662, 16989814, 17603484, 18060660, 18688868, 21602428, 21713316, 22238590, 22662265, 23429432, 23851660, 23903355, 26426397, 28432734 View all (16 more)
Diabetes Mellitus Transient Neonatal 1	Associate	28468959, 37897565
Diabetes Mellitus Type 1	Associate	28432734, 31276222, 33538814, 36418577
Diabetes Mellitus Type 2	Associate	17603484, 18040659, 18060660, 18426861, 18694974, 19020324, 19258739, 20028947, 20361036, 20509872, 21713316, 22275441, 22389004, 22662265, 23144361 View all (16 more)
Diabetic Retinopathy	Associate	28821857, 39719581
Disease	Associate	21713316, 35469785, 36161854
Disruptive Impulse Control and Conduct Disorders	Associate	19328217
Dykes Markes Harper syndrome	Associate	37897565
Endometrial Neoplasms	Associate	34337010
Eye Diseases Hereditary	Associate	36729443
Glucose Intolerance	Associate	21602428
Graves Disease	Associate	18688868
Growth Disorders	Associate	37897565
Hearing Disorders	Associate	28039263
Hearing Loss	Associate	16648378, 17517145, 17846994, 18518985, 20069065, 21538838, 22240535, 28039263, 32419160, 32567228, 34258273, 34573359, 34753855, 35322580, 36225977 View all (4 more)
Hearing Loss Noise Induced	Associate	22240535
Hearing Loss Sensorineural	Associate	17517145, 21538838, 28468959, 32567228, 32938580, 34258273, 39422244
Hyperaldosteronism Familial Type II	Associate	36384999
Hyperglycemia	Associate	39766859
Hypertension	Associate	21713316
Hypoglycemia	Associate	21602428
Inflammation	Associate	33693650, 36980809
Kidney Diseases	Associate	27151922
Lymphoma Non Hodgkin	Associate	34258273
Mason Type Diabetes	Associate	40641032
Maturity Onset Diabetes of the Young Type 2	Associate	23903355
Mental Disorders	Associate	15473915, 18688868, 19328217, 32938580, 35206658
Mitochondrial Diseases	Associate	37163979
Mitochondrial Myopathy with a Defect in Mitochondrial Protein Transport	Associate	37163979
Mood Disorders	Associate	15473915, 19328217
Mucolipidosis III Gamma	Associate	37897565
Muscle Hypotonia	Associate	28468959
Muscle Weakness	Associate	36781206
Myotonic Dystrophy	Associate	22238590
Nervous System Diseases	Associate	36833385
Neurodegenerative Diseases	Associate	18040659, 36967753, 36982670
Neurologic Manifestations	Associate	23596069
Non alcoholic Fatty Liver Disease	Associate	33194991
Nonsyndromic Deafness	Associate	17846994, 23990876, 24612839, 28432734, 31389194, 34837038
Nonsyndromic Deafness	Stimulate	25388789
Nonsyndromic sensorineural hearing loss	Associate	17517145, 31937257, 32382995, 32567228
Obesity	Associate	36980809, 37859980
Optic Atrophies Hereditary	Associate	34573359
Optic Atrophy	Associate	12707373, 16648378, 16989814, 17846994, 18060660, 18688868, 19258739, 21538838, 21713316, 22238590, 23429432, 25255707, 29549887, 31937257, 32938580 View all (5 more)
Optic Atrophy Autosomal Dominant	Associate	16648378, 39363032
Optic Nerve Diseases	Associate	20069065, 35469785, 39363032
Osteoarthritis	Associate	22238590, 39363032
Parkinson Disease	Associate	18688868
Peptic Ulcer	Stimulate	28335035
Polycystic Ovary Syndrome	Associate	22389004
Prediabetic State	Associate	36980809
Psychological Trauma	Associate	37399203
Pulmonary Disease Chronic Obstructive	Associate	36445321
Renal Insufficiency	Associate	23903355
Retinal Diseases	Associate	36161854
Retinitis Pigmentosa	Associate	37493686
Sleep Wake Disorders	Associate	37399203
Syndrome	Associate	27151922
Thiamine responsive megaloblastic anemia syndrome	Associate	28432734
Thyroid Neoplasms	Associate	34167437
Tinnitus	Associate	35322580
Tomaculous neuropathy	Stimulate	28335035
Tooth Loss	Associate	35469785
Uniparental Disomy	Inhibit	25255707
Uniparental Disomy	Associate	34360843
Urologic Diseases	Associate	29549887, 32938580
Vestibular Diseases	Associate	36833385
Vestibular Diseases	Stimulate	36833385
Vision Disorders	Associate	34006618, 35469785
Waardenburg Syndrome	Associate	32938580
Wolfram Like Syndrome Autosomal Dominant	Associate	16648378, 27217304, 36933359, 39422244, 39766859, 40641032
Wolfram Syndrome	Associate	10521293, 12490066, 12707373, 15149303, 16442662, 16648378, 16989814, 17603484, 18040659, 18060660, 18566338, 18688868, 19258739, 19328217, 21602428 View all (50 more)
Wolfram Syndrome	Stimulate	33879837, 40202504
Wolfram Syndrome 2	Associate	28432734

WFS1 (wolframin ER transmembrane glycoprotein)