Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7465
Gene name Gene Name - the full gene name approved by the HGNC.
WEE1 G2 checkpoint kinase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
WEE1
Synonyms (NCBI Gene) Gene synonyms aliases
WEE1A, WEE1hu
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p15.4
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a nuclear protein, which is a tyrosine kinase belonging to the Ser/Thr family of protein kinases. This protein catalyzes the inhibitory tyrosine phosphorylation of CDC2/cyclin B kinase, and appears to coordinate the transition between DN
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000659 hsa-miR-424-5p Luciferase reporter assay 19956200
MIRT000644 hsa-miR-503-5p Luciferase reporter assay 19956200
MIRT000222 hsa-miR-195-5p ELISA, GFP reporter assay, Luciferase reporter assay, Microarray, qRT-PCR, Western blot 19823043
MIRT000222 hsa-miR-195-5p ELISA, GFP reporter assay, Luciferase reporter assay, Microarray, qRT-PCR, Western blot 19823043
MIRT000057 hsa-miR-372-3p Luciferase reporter assay 19823043
Transcription factors
Transcription factor Regulation Reference
AR Repression 16281084
KDM4B Unknown 20682797
KLF2 Repression 15735666
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000086 Process G2/M transition of mitotic cell cycle IDA 2188730
GO:0000086 Process G2/M transition of mitotic cell cycle TAS
GO:0000166 Function Nucleotide binding IEA
GO:0000226 Process Microtubule cytoskeleton organization IEA
GO:0000278 Process Mitotic cell cycle IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
193525 12761 ENSG00000166483
Protein
UniProt ID P30291
Protein name Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase)
Protein function Acts as a negative regulator of entry into mitosis (G2 to M transition) by protecting the nucleus from cytoplasmically activated cyclin B1-complexed CDK1 before the onset of mitosis by mediating phosphorylation of CDK1 on 'Tyr-15' (PubMed:150707
PDB 1X8B , 2IN6 , 2IO6 , 2Z2W , 3BI6 , 3BIZ , 3CQE , 3CR0 , 5V5Y , 5VC3 , 5VC4 , 5VC5 , 5VC6 , 5VD2 , 5VD4 , 5VD5 , 5VD7 , 5VD8 , 5VD9 , 5VDA , 7N3U , 8BJU , 8WDK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 299 569 Protein kinase domain Domain
Sequence
MSFLSRQQPPPPRRAGAACTLRQKLIFSPCSDCEEEEEEEEEEGSGHSTGEDSAFQEPDS
PLPPARSPTEPGPERRRSPGPAPGSPGELEEDLLLPGACPGADEAGGGAEGDSWEEEGFG
SSSPVKSPAAPYFLGSSFSPVRCGGPGDASPRGCGARRAGEGRRSPRPDHPGTPPHKTFR
KLRLFDTPHTPKSLLSKARGIDSSSVKLRGSSLFMDTEKSGKREFDVRQTPQVNINPFTP
DSLLLHSSGQCRRRKRTYWNDSCGEDMEASDYELEDETRPAKRITITESNMKSRYTTEFH
ELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVV
RYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSM
SLVHMDIKPSNIFISRTSIPNAASEEGDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDS
RFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQ
EFTELLKVMIHPDPERRPSAMALVKHSVL
LSASRKSAEQLRIELNAEKFKNSLLQKELKK
AQMAKAAAEERALFTDRMATRSTTQSNRTSRLIGKKMNRSVSLTIY
Sequence length 646
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell cycle
Human immunodeficiency virus 1 infection
  Polo-like kinase mediated events
Cyclin E associated events during G1/S transition
Cyclin A/B1/B2 associated events during G2/M transition
G2/M DNA replication checkpoint
Cyclin A:Cdk2-associated events at S phase entry
Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Hepatocellular Carcinoma Hepatocellular carcinoma Treatment with the WEE1 inhibitor AZD1775 robustly inhibited the growth of several ATRX-deficient HCC cell lines in vitro, as well as xenografts in vivo. 31551363 CBGDA
Malignant Mesothelioma Malignant Pleural Mesothelioma We further showed that deregulation of the G2-M checkpoint contributes to chemotherapy resistance, and that WEE1 inhibition synergizes with cisplatin/MTA, leading to enhanced MPM cell death in vitro and potent antitumor effects in vivo. 31694888 CBGDA
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 37863324
Alzheimer Disease Associate 25649652
Ataxia Telangiectasia Associate 33529438
Atrial Fibrillation Associate 33015181
Biliary Tract Neoplasms Associate 34352995
Breast Neoplasms Associate 19357772, 19821025, 22112940, 24377575, 28335434
Calcinosis Cutis Associate 30499870
Carcinogenesis Associate 23778472
Carcinoma Associate 35315355
Carcinoma Hepatocellular Associate 26975930, 28178688, 30805988, 30915746, 36595671