Gene Gene information from NCBI Gene database.
Entrez ID 7465
Gene name WEE1 G2 checkpoint kinase
Gene symbol WEE1
Synonyms (NCBI Gene)
WEE1AWEE1hu
Chromosome 11
Chromosome location 11p15.4
Summary This gene encodes a nuclear protein, which is a tyrosine kinase belonging to the Ser/Thr family of protein kinases. This protein catalyzes the inhibitory tyrosine phosphorylation of CDC2/cyclin B kinase, and appears to coordinate the transition between DN
miRNA miRNA information provided by mirtarbase database.
1405
miRTarBase ID miRNA Experiments Reference
MIRT000659 hsa-miR-424-5p Luciferase reporter assay 19956200
MIRT000644 hsa-miR-503-5p Luciferase reporter assay 19956200
MIRT000222 hsa-miR-195-5p ELISAGFP reporter assayLuciferase reporter assayMicroarrayqRT-PCRWestern blot 19823043
MIRT000222 hsa-miR-195-5p ELISAGFP reporter assayLuciferase reporter assayMicroarrayqRT-PCRWestern blot 19823043
MIRT000057 hsa-miR-372-3p Luciferase reporter assay 19823043
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
AR Repression 16281084
KDM4B Unknown 20682797
KLF2 Repression 15735666
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
35
GO ID Ontology Definition Evidence Reference
GO:0000086 Process G2/M transition of mitotic cell cycle IDA 2188730
GO:0000086 Process G2/M transition of mitotic cell cycle TAS
GO:0000166 Function Nucleotide binding IEA
GO:0000226 Process Microtubule cytoskeleton organization IEA
GO:0000278 Process Mitotic cell cycle IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
193525 12761 ENSG00000166483
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P30291
Protein name Wee1-like protein kinase (WEE1hu) (EC 2.7.10.2) (Wee1A kinase)
Protein function Acts as a negative regulator of entry into mitosis (G2 to M transition) by protecting the nucleus from cytoplasmically activated cyclin B1-complexed CDK1 before the onset of mitosis by mediating phosphorylation of CDK1 on 'Tyr-15' (PubMed:150707
PDB 1X8B , 2IN6 , 2IO6 , 2Z2W , 3BI6 , 3BIZ , 3CQE , 3CR0 , 5V5Y , 5VC3 , 5VC4 , 5VC5 , 5VC6 , 5VD2 , 5VD4 , 5VD5 , 5VD7 , 5VD8 , 5VD9 , 5VDA , 7N3U , 8BJU , 8WDK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 299 569 Protein kinase domain Domain
Sequence
MSFLSRQQPPPPRRAGAACTLRQKLIFSPCSDCEEEEEEEEEEGSGHSTGEDSAFQEPDS
PLPPARSPTEPGPERRRSPGPAPGSPGELEEDLLLPGACPGADEAGGGAEGDSWEEEGFG
SSSPVKSPAAPYFLGSSFSPVRCGGPGDASPRGCGARRAGEGRRSPRPDHPGTPPHKTFR
KLRLFDTPHTPKSLLSKARGIDSSSVKLRGSSLFMDTEKSGKREFDVRQTPQVNINPFTP
DSLLLHSSGQCRRRKRTYWNDSCGEDMEASDYELEDETRPAKRITITESNMKSRYTTEFH
ELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVV
RYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSM
SLVHMDIKPSNIFISRTSIPNAASEEGDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDS
RFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQ
EFTELLKVMIHPDPERRPSAMALVKHSVL
LSASRKSAEQLRIELNAEKFKNSLLQKELKK
AQMAKAAAEERALFTDRMATRSTTQSNRTSRLIGKKMNRSVSLTIY
Sequence length 646
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cell cycle
Human immunodeficiency virus 1 infection
  Polo-like kinase mediated events
Cyclin E associated events during G1/S transition
Cyclin A/B1/B2 associated events during G2/M transition
G2/M DNA replication checkpoint
Cyclin A:Cdk2-associated events at S phase entry
Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex