Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7461
Gene name Gene Name - the full gene name approved by the HGNC.	CAP-Gly domain containing linker protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CLIP2
Synonyms (NCBI Gene) Gene synonyms aliases	CLIP, CLIP-115, CYLN2, WBSCR3, WBSCR4, WSCR3, WSCR4
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q11.23
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the family of cytoplasmic linker proteins, which have been proposed to mediate the interaction between specific membranous organelles and microtubules. This protein was found to associate with both microtubules

Show/Hide all(110)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017277	hsa-miR-335-5p	Microarray	18185580
MIRT051153	hsa-miR-16-5p	CLASH	23622248
MIRT494214	hsa-miR-219a-5p	PAR-CLIP	23592263
MIRT494213	hsa-miR-4782-3p	PAR-CLIP	23592263
MIRT494212	hsa-miR-6766-3p	PAR-CLIP	23592263
MIRT494211	hsa-miR-1911-5p	PAR-CLIP	23592263
MIRT494210	hsa-miR-3960	PAR-CLIP	23592263
MIRT494209	hsa-miR-8072	PAR-CLIP	23592263
MIRT494208	hsa-miR-4450	PAR-CLIP	23592263
MIRT494207	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT494205	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT494206	hsa-miR-5698	PAR-CLIP	23592263
MIRT494204	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT494203	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT494202	hsa-miR-4525	PAR-CLIP	23592263
MIRT494201	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT494200	hsa-miR-1275	PAR-CLIP	23592263
MIRT494199	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT440934	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440934	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT494214	hsa-miR-219a-5p	PAR-CLIP	23592263
MIRT494213	hsa-miR-4782-3p	PAR-CLIP	23592263
MIRT494212	hsa-miR-6766-3p	PAR-CLIP	23592263
MIRT494211	hsa-miR-1911-5p	PAR-CLIP	23592263
MIRT494210	hsa-miR-3960	PAR-CLIP	23592263
MIRT494209	hsa-miR-8072	PAR-CLIP	23592263
MIRT494208	hsa-miR-4450	PAR-CLIP	23592263
MIRT494207	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT494205	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT494206	hsa-miR-5698	PAR-CLIP	23592263
MIRT494204	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT494203	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT494202	hsa-miR-4525	PAR-CLIP	23592263
MIRT494201	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT494200	hsa-miR-1275	PAR-CLIP	23592263
MIRT494199	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT896557	hsa-miR-1226	CLIP-seq
MIRT896558	hsa-miR-1254	CLIP-seq
MIRT896559	hsa-miR-1257	CLIP-seq
MIRT896560	hsa-miR-1910	CLIP-seq
MIRT896561	hsa-miR-193a-5p	CLIP-seq
MIRT896562	hsa-miR-1976	CLIP-seq
MIRT896563	hsa-miR-24	CLIP-seq
MIRT896564	hsa-miR-3116	CLIP-seq
MIRT896565	hsa-miR-3137	CLIP-seq
MIRT896566	hsa-miR-3150a-3p	CLIP-seq
MIRT896567	hsa-miR-3151	CLIP-seq
MIRT896568	hsa-miR-3154	CLIP-seq
MIRT896569	hsa-miR-3175	CLIP-seq
MIRT896570	hsa-miR-377	CLIP-seq
MIRT896571	hsa-miR-4254	CLIP-seq
MIRT896572	hsa-miR-4264	CLIP-seq
MIRT896573	hsa-miR-4268	CLIP-seq
MIRT896574	hsa-miR-4283	CLIP-seq
MIRT896575	hsa-miR-4318	CLIP-seq
MIRT896576	hsa-miR-432	CLIP-seq
MIRT896577	hsa-miR-4437	CLIP-seq
MIRT896578	hsa-miR-4447	CLIP-seq
MIRT896579	hsa-miR-4472	CLIP-seq
MIRT896580	hsa-miR-4520a-3p	CLIP-seq
MIRT896581	hsa-miR-4520b-3p	CLIP-seq
MIRT896582	hsa-miR-455-3p	CLIP-seq
MIRT896583	hsa-miR-4639-3p	CLIP-seq
MIRT896584	hsa-miR-4663	CLIP-seq
MIRT896585	hsa-miR-4722-3p	CLIP-seq
MIRT896586	hsa-miR-4728-5p	CLIP-seq
MIRT896587	hsa-miR-4733-3p	CLIP-seq
MIRT896588	hsa-miR-4797-3p	CLIP-seq
MIRT896589	hsa-miR-491-5p	CLIP-seq
MIRT896590	hsa-miR-661	CLIP-seq
MIRT896591	hsa-miR-665	CLIP-seq
MIRT896592	hsa-miR-765	CLIP-seq
MIRT896593	hsa-miR-939	CLIP-seq
MIRT896578	hsa-miR-4447	CLIP-seq
MIRT896579	hsa-miR-4472	CLIP-seq
MIRT1546497	hsa-miR-4651	CLIP-seq
MIRT1546498	hsa-miR-608	CLIP-seq
MIRT1546499	hsa-miR-625	CLIP-seq
MIRT1546500	hsa-miR-638	CLIP-seq
MIRT1965834	hsa-miR-1285	CLIP-seq
MIRT1965835	hsa-miR-3187-5p	CLIP-seq
MIRT1965836	hsa-miR-326	CLIP-seq
MIRT1965837	hsa-miR-330-5p	CLIP-seq
MIRT1965838	hsa-miR-3943	CLIP-seq
MIRT1965839	hsa-miR-4488	CLIP-seq
MIRT1965840	hsa-miR-4514	CLIP-seq
MIRT1965841	hsa-miR-4667-5p	CLIP-seq
MIRT1965842	hsa-miR-4692	CLIP-seq
MIRT1965843	hsa-miR-4697-5p	CLIP-seq
MIRT1965844	hsa-miR-4700-5p	CLIP-seq
MIRT1965845	hsa-miR-4749-3p	CLIP-seq
MIRT1965846	hsa-miR-612	CLIP-seq
MIRT1965847	hsa-miR-637	CLIP-seq
MIRT1965848	hsa-miR-720	CLIP-seq
MIRT1965849	hsa-miR-940	CLIP-seq
MIRT896575	hsa-miR-4318	CLIP-seq
MIRT896586	hsa-miR-4728-5p	CLIP-seq
MIRT2386177	hsa-miR-22	CLIP-seq
MIRT896586	hsa-miR-4728-5p	CLIP-seq
MIRT2447190	hsa-miR-3622a-5p	CLIP-seq
MIRT2447191	hsa-miR-4423-3p	CLIP-seq
MIRT2447192	hsa-miR-4650-5p	CLIP-seq
MIRT896585	hsa-miR-4722-3p	CLIP-seq
MIRT2447193	hsa-miR-4755-3p	CLIP-seq
MIRT2447194	hsa-miR-564	CLIP-seq
MIRT896590	hsa-miR-661	CLIP-seq
MIRT896565	hsa-miR-3137	CLIP-seq
MIRT896570	hsa-miR-377	CLIP-seq
MIRT896583	hsa-miR-4639-3p	CLIP-seq
MIRT2504683	hsa-miR-4718	CLIP-seq

Show/Hide all(8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005875	Component	Microtubule associated complex	TAS	9799601
GO:0008017	Function	Microtubule binding	ISS
GO:0031122	Process	Cytoplasmic microtubule organization	IBA	21873635
GO:0035371	Component	Microtubule plus-end	IBA	21873635
GO:0035371	Component	Microtubule plus-end	ISS
GO:0051010	Function	Microtubule plus-end binding	IBA	21873635

MIM	HGNC	e!Ensembl
603432	2586	ENSG00000106665

Protein

UniProt ID

Q9UDT6

Protein name

CAP-Gly domain-containing linker protein 2 (Cytoplasmic linker protein 115) (CLIP-115) (Cytoplasmic linker protein 2) (Williams-Beuren syndrome chromosomal region 3 protein) (Williams-Beuren syndrome chromosomal region 4 protein)

Protein function

Seems to link microtubules to dendritic lamellar body (DLB), a membranous organelle predominantly present in bulbous dendritic appendages of neurons linked by dendrodendritic gap junctions. May operate in the control of brain-specific organelle

PDB

2CP2 , 2CP3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01302	CAP_GLY	81 → 145	CAP-Gly domain	Domain
PF01302	CAP_GLY	221 → 285	CAP-Gly domain	Domain

Sequence

MQKPSGLKPPGRGGKHSSPMGRTSTGSASSSAAVAASSKEGSPLHKQSSGPSSSPAAAAA
PEKPGPKAAEVGDDFLGDFVVGERVWVNGVKPGVVQYLGETQFAPGQWAGVVLDDPVGKN
DGAVGGVRYFECPALQGIFTRPSKLTRQPTAEGSGSDAHSVESLTAQNLSLHSGTATPPL
TSRVIPLRESVLNSSVKTGNESGSNLSDSGSVKRGEKDLRLGDRVLVGGTKTGVVRYVGE
TDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGFPSTSPAKAKK
TKRMAMGVSALTHSPSSSSISSVSSVASSVGGRPSRSGLLTETSSRYARKISGTTALQEA
LKEKQQHIEQLLAERDLERAEVAKATSHICEVEKEIALLKAQHEQYVAEAEEKLQRARLL
VESVRKEKVDLSNQLEEERRKVEDLQFRVEEESITKGDLETQTQLEHARIGELEQSLLLE
KAQAERLLRELADNRLTTVAEKSRVLQLEEELTLRRGEIEELQQCLLHSGPPPPDHPDAA
EILRLRERLLSASKEHQRESGVLRDKYEKALKAYQAEVDKLRAANEKYAQEVAGLKDKVQ
QATSENMGLMDNWKSKLDSLASDHQKSLEDLKATLNSGPGAQQKEIGELKAVMEGIKMEH
QLELGNLQAKHDLETAMHVKEKEALREKLQEAQEELAGLQRHWRAQLEVQASQHRLELQE
AQDQRRDAELRVHELEKLDVEYRGQAQAIEFLKEQISLAEKKMLDYERLQRAEAQGKQEV
ESLREKLLVAENRLQAVEALCSSQHTHMIESNDISEETIRTKETVEGLQDKLNKRDKEVT
ALTSQTEMLRAQVSALESKCKSGEKKVDALLKEKRRLEAELETVSRKTHDASGQLVLISQ
ELLRKERSLNELRVLLLEANRHSPGPERDLSREVHKAEWRIKEQKLKDDIRGLREKLTGL
DKEKSLSDQRRYSLIDRSSAPELLRLQHQLMSTEDALRDALDQAQQVEKLMEAMRSCPDK
AQTIGNSGSANGIHQQDKAQKQEDKH

Sequence length

1046

Interactions

View interactions

Show/Hide Causal Diseases (33)

Disease term	Disease name	dbSNP ID
Causal
Atrial septal defect	Atrial Septal Defects	rs137852951, rs137852953, rs137852955, rs267607106, rs104893900, rs104893901, rs104893903, rs606231358, rs606231359, rs137852683, rs606231360, rs104893907, rs104894073, rs1585703301, rs104894074 View all (25 more)
Attention deficit hyperactivity disorder	Attention deficit hyperactivity disorder	rs786205019
Autism	Autistic Disorder	rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699 View all (8 more)
Bicuspid aortic valve	Bicuspid aortic valve	rs1569484234, rs1569484208
Cataract	Cataract	rs118203965, rs118203966, rs104893685, rs121908938, rs104894175, rs121909048, rs28937573, rs121909049, rs121909050, rs74315488, rs80358200, rs80358203, rs121434643, rs56141211, rs132630322 View all (150 more)
Cholelithiasis	Cholelithiasis	rs121918440, rs72552778, rs387906528, rs759202962, rs377160065, rs1051861187, rs757693457, rs752563752
Cornea plana	Cornea plana	rs121917858, rs121917860, rs121917862, rs121917863, rs386833985, rs386833986, rs757611751
Cryptorchidism	Cryptorchidism	rs121912555, rs104894697, rs104894698, rs398122886
Developmental regression	Developmental regression	rs1224421127
Diabetes mellitus	Diabetes Mellitus, Non-Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)
Glaucoma	Glaucoma	rs121918355, rs1566660365, rs1566635134, rs121918356, rs1566634475, rs28936700, rs55771538, rs28936701, rs104893622, rs55989760, rs72549387, rs104893628, rs2125316417, rs104893629, rs74315328 View all (29 more)
Hearing loss	Sensorineural Hearing Loss (disorder)	rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359 View all (184 more)
Hypercalcemia	Hypercalcemia	rs876657376, rs387907322, rs777676129, rs387907323, rs114368325, rs6068812, rs387907324, rs777947329, rs201304511, rs769409705, rs200095793, rs876661338, rs1554095500, rs139763321, rs774432244, rs781367354 View all (1 more)
Hypertension	Hypertension, Renovascular	rs13306026
Hypertrophic cardiomyopathy	Hypertrophic Cardiomyopathy	rs63750743, rs104894655, rs121908987, rs587776643, rs28938173, rs121908989, rs121908991, rs267606977, rs267606978, rs193922384, rs121909374, rs886041030, rs886041031, rs121909375, rs121909377 View all (752 more)
Hypogonadotropic hypogonadism	Hypogonadotropic hypogonadism	rs104894702, rs104893836, rs104893837, rs104893842, rs121909628, rs138249161, rs1601946139
Hypothyroidism	Hypothyroidism	rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912 View all (22 more)
Mental retardation	Intellectual Disability	rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315 View all (1024 more)
Microcephaly	Microcephaly	rs397704721, rs267607176, rs267607177, rs397704725, rs267606717, rs267606718, rs199422202, rs121434311, rs199422203, rs199422126, rs387906274, rs121434305, rs199422125, rs199422135, rs189678019 View all (280 more)
Mitral valve prolapse	Mitral Valve Prolapse Syndrome	rs768737101
Myopathy	Myopathy	rs137854521, rs386834236, rs121908557, rs121909092, rs111033570, rs104894299, rs104894294, rs121909273, rs121909274, rs121909275, rs199474699, rs199476140, rs118192165, rs118192169, rs118192166 View all (81 more)
Myopia	Myopia	rs387907109, rs146936371, rs587776903, rs786205127, rs398122836, rs199624584, rs587777625, rs786205216, rs758872875, rs764211125, rs1135402746, rs765658563, rs1555941129, rs1555941116, rs199923805 View all (6 more)
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562 View all (27 more)
Osteoporosis	Osteoporosis	rs72658152, rs72667023, rs587776916, rs72656370, rs768615287
Patent ductus arteriosus	Patent ductus arteriosus	rs80338911, rs879253870, rs879253871, rs879255278, rs879255279, rs879253872
Precocious puberty	Precocious Puberty	rs879255238, rs879255239, rs879255240, rs1264639964, rs1566764505
Radioulnar synostosis	Radioulnar Synostosis	rs1595756416, rs1595756703, rs1231501584, rs1595756962, rs1595757203, rs1595763070, rs1595766210
Renal insufficiency	Renal Insufficiency	rs1596536873
Scoliosis	Scoliosis, unspecified	rs1057518828, rs147296805, rs758163506, rs1555613564, rs1596852902, rs1596853067, rs1596853085
Supravalvar aortic stenosis	Supravalvular aortic stenosis	rs137854452, rs137854453, rs2132322943, rs1563826213, rs137854454, rs137854455, rs1554686162, rs397516433, rs727503783, rs727503782, rs727503022, rs727503023, rs727503024, rs727503026, rs727503027 View all (38 more)
Tetralogy of fallot	Tetralogy of Fallot	rs28939668, rs727504412, rs864321649, rs774966208, rs876660981, rs886044220, rs1114167357, rs1569484126, rs1569484164, rs1569484122, rs1569484124, rs1569484042, rs1569484120, rs1569484299, rs1569484301, rs1569484288 View all (1 more)
Ventricular septal defect	Ventricular Septal Defects	rs104894073, rs387906775
Vesicoureteral reflux	Vesico-Ureteral Reflux	rs587777684, rs148731211

Show/Hide Unknown Diseases (8)

Disease term	Disease name	Source
Unknown
Congestive heart failure	Congestive heart failure	ClinVar
Mental depression	Depressive disorder	ClinVar
Myocardial infarction	Myocardial Infarction	ClinVar
Otitis media	Chronic otitis media	ClinVar
Renal hypoplasia	Congenital hypoplasia of kidney	ClinVar
Williams syndrome	Williams syndrome	ClinVar
Systemic lupus erythematosus	Systemic lupus erythematosus	GWAS
Alzheimer disease	Alzheimer disease	GWAS

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining
Antiphospholipid Syndrome	Associate	25301710
Carcinogenesis	Associate	27729373
Hyperostosis Diffuse Idiopathic Skeletal	Associate	22608712
Memory Disorders	Associate	22608712
Neoplasm Metastasis	Associate	32727620
Neoplasms	Associate	31219820, 32727620, 36446043
Post Infectious Disorders	Associate	25957251
Thrombosis	Associate	25301710
Thyroid Cancer Papillary	Associate	25957251, 27729373, 32727620
Thyroid Neoplasms	Associate	32727620
Williams Syndrome	Associate	17827280, 22411788, 25105779, 33208191, 33564861

CLIP2 (CAP-Gly domain containing linker protein 2)