Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7454
Gene name	WASP actin nucleation promoting factor
Gene symbol	WAS
Synonyms (NCBI Gene)	IMD2SCNXTHCTHC1WASPWASPA
Chromosome	X
Chromosome location	Xp11.23
Summary	The Wiskott-Aldrich syndrome (WAS) family of proteins share similar domain structure, and are involved in transduction of signals from receptors on the cell surface to the actin cytoskeleton. The presence of a number of different motifs suggests that the

Show/Hide all (64)

SNP ID	Visualize variation	Clinical significance	Consequence
rs132630268	G>A,C,T	Pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs132630269	C>T	Pathogenic	Coding sequence variant, missense variant
rs132630270	C>G	Pathogenic	Coding sequence variant, missense variant
rs132630271	C>A,T	Pathogenic	Coding sequence variant, synonymous variant, stop gained
rs132630272	T>C	Pathogenic	Coding sequence variant, missense variant
rs132630273	C>T	Pathogenic	Coding sequence variant, missense variant
rs132630274	T>C	Pathogenic	Coding sequence variant, missense variant
rs132630275	C>A,G	Pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs132630276	T>A	Pathogenic	Coding sequence variant, missense variant
rs139265251	G>A,C	Not-provided, pathogenic, benign	Coding sequence variant, missense variant
rs145040665	C>A,T	Conflicting-interpretations-of-pathogenicity, likely-benign	Missense variant, coding sequence variant
rs150520117	C>T	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs193922412	ACCGCCACC>-,ACCGCCACCACCGCCACC	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Inframe deletion, coding sequence variant, inframe insertion
rs193922414	C>G,T	Likely-pathogenic	Missense variant, coding sequence variant, stop gained
rs193922415	C>T	Pathogenic	Coding sequence variant, stop gained
rs193922416	->C	Likely-pathogenic	Frameshift variant, coding sequence variant
rs368151220	C>A,T	Pathogenic	Synonymous variant, coding sequence variant, stop gained
rs387906716	T>C	Pathogenic	Missense variant, coding sequence variant
rs387906717	T>C	Pathogenic	Missense variant, coding sequence variant
rs587776742	A>T	Pathogenic	Missense variant, initiator codon variant
rs587776743	->ACGAGG	Pathogenic	Inframe insertion, coding sequence variant
rs587776744	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs587776745	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs781799471	G>A	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs782290433	G>A	Pathogenic	Coding sequence variant, missense variant
rs886039451	G>A,C	Likely-pathogenic, pathogenic	Intron variant
rs886041379	->C	Pathogenic	Frameshift variant, coding sequence variant
rs1057517845	G>A	Pathogenic	Splice donor variant
rs1057518633	->CCACCACC	Pathogenic	Frameshift variant, coding sequence variant
rs1057520700	G>A,C,T	Pathogenic	Splice donor variant
rs1064793292	->GGGAATGGACCAGCCCC	Pathogenic	Frameshift variant, coding sequence variant
rs1064793293	G>A	Pathogenic	Missense variant, coding sequence variant
rs1064793974	G>T	Pathogenic	Coding sequence variant, stop gained
rs1064794076	G>A	Pathogenic	Splice donor variant
rs1085307678	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs1557006239	G>A	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs1557006316	TACCT>AACCTGGCGCTGCCCCC	Likely-pathogenic	Inframe indel, coding sequence variant
rs1557006354	C>T	Pathogenic	Stop gained, coding sequence variant
rs1557006474	G>A	Likely-pathogenic	Stop gained, coding sequence variant
rs1557006672	C>T	Likely-pathogenic	Stop gained, coding sequence variant
rs1557007011	G>A	Pathogenic	Intron variant
rs1557007035	C>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1557007123	C>T	Pathogenic	Intron variant, stop gained, coding sequence variant
rs1557007165	C>-	Pathogenic	Intron variant, frameshift variant, coding sequence variant
rs1557007312	->G	Pathogenic	Frameshift variant, coding sequence variant
rs1569493877	T>A	Pathogenic	Splice donor variant
rs1569494025	G>-	Pathogenic	Coding sequence variant, frameshift variant, intron variant
rs1602176146	CAGAGCCTCGCCAGAGAAGACAAGGGCAGAAAGCACCATGAGTGGGGGCCCAATGGGAGGAAGGCCCGGGGGCCGAGGAGCACCAGCGGTTCAGCAGAACATACCCTCCACCCTCCTCCAGGACCACGAGAACCAGCGACTCTTTGAGATGCTTGGACGAAAATGCTTGGTGAGCTGGGGATCTCCTGCCCCCGCCCCGTCCCC>-	Pathogenic	Splice donor variant, 5 prime UTR variant, initiator codon variant, intron variant
rs1602176222	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1602176299	AC>-	Pathogenic	Coding sequence variant, frameshift variant
rs1602177243	G>T	Pathogenic	Coding sequence variant, stop gained
rs1602177562	GC>-	Pathogenic	Coding sequence variant, frameshift variant
rs1602177733	T>G	Pathogenic	Splice donor variant
rs1602178087	G>A	Pathogenic	Splice acceptor variant
rs1602178165	C>T	Pathogenic	Coding sequence variant, stop gained
rs1602178184	TAGCC>-	Pathogenic	Coding sequence variant, frameshift variant
rs1602178267	G>A	Pathogenic	Intron variant
rs1602178800	A>G	Pathogenic	Splice acceptor variant
rs1602178952	G>TT	Pathogenic	Coding sequence variant, frameshift variant
rs1602179000	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs1602179794	CGGCAGGGAATTCAGCTGAACAAGGTGAGGACAGGCAGGATGGAGGATTGGGGGTCTAGGACTCTGGGGTGTCCCGTCTAAGTCAGGATACTGGGGGGCTGAGGCCAGGACTGAGGAGAGTGCCAGGCCTTAGGGATTCAGTGATAGGGTTGAAAGGTTGGTGGGAAGCCTTGAAGGGGACTGGAGTGTGTGGGAGAGAAAATATTGATGGAGGGGCGGGGAGAAATGCTCCTTTCCCAGGCCCTAAGCCCTCTG	Pathogenic	Coding sequence variant, splice acceptor variant, intron variant, splice donor variant
rs1602179810	AGGTGAGGACA>-	Pathogenic	Coding sequence variant, splice donor variant, intron variant
rs1602180020	A>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1602180058	C>T	Pathogenic	Coding sequence variant, stop gained

Show/Hide all (20)

miRTarBase ID	miRNA	Experiments
MIRT1488620	hsa-miR-1207-5p	CLIP-seq
MIRT1488621	hsa-miR-1224-5p	CLIP-seq
MIRT1488622	hsa-miR-1262	CLIP-seq
MIRT1488623	hsa-miR-1294	CLIP-seq
MIRT1488624	hsa-miR-3147	CLIP-seq
MIRT1488625	hsa-miR-3659	CLIP-seq
MIRT1488626	hsa-miR-4310	CLIP-seq
MIRT1488627	hsa-miR-4316	CLIP-seq
MIRT1488628	hsa-miR-4425	CLIP-seq
MIRT1488629	hsa-miR-4443	CLIP-seq
MIRT1488630	hsa-miR-4514	CLIP-seq
MIRT1488631	hsa-miR-4645-5p	CLIP-seq
MIRT1488632	hsa-miR-4658	CLIP-seq
MIRT1488633	hsa-miR-4673	CLIP-seq
MIRT1488634	hsa-miR-4692	CLIP-seq
MIRT1488635	hsa-miR-4701-3p	CLIP-seq
MIRT1488636	hsa-miR-4751	CLIP-seq
MIRT1488637	hsa-miR-4763-3p	CLIP-seq
MIRT1488638	hsa-miR-574-5p	CLIP-seq
MIRT1488639	hsa-miR-940	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
ETS1	Unknown	10066431
MYB	Unknown	10066431
SP1	Unknown	10066431
SPI1	Unknown	10066431

Show/Hide all (53)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002625	Process	Regulation of T cell antigen processing and presentation	IMP	22804504
GO:0003779	Function	Actin binding	IEA
GO:0005515	Function	Protein binding	IPI	8892607, 9405671, 9422512, 9660763, 10202051, 12029088, 12235133, 12591280, 15169891, 15361624, 16488394, 17213309, 17242350, 18650809, 19234535, 19487689, 19805221, 19817875, 20936779, 21516116, 21988832, 22252508, 25416956, 25502805, 29248492, 31515488, 32296183
GO:0005634	Component	Nucleus	IDA	20574068, 29925947
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	8625410
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005884	Component	Actin filament	IDA	8625410
GO:0005886	Component	Plasma membrane	IDA
GO:0005911	Component	Cell-cell junction	IEA
GO:0006952	Process	Defense response	IEA
GO:0006952	Process	Defense response	TAS	8069912
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	IMP	8069912
GO:0007015	Process	Actin filament organization	IEA
GO:0007266	Process	Rho protein signal transduction	IMP	8625410
GO:0007596	Process	Blood coagulation	TAS	8069912
GO:0008064	Process	Regulation of actin polymerization or depolymerization	IMP	8625410
GO:0008154	Process	Actin polymerization or depolymerization	IEA
GO:0008154	Process	Actin polymerization or depolymerization	TAS	8625410
GO:0008544	Process	Epidermis development	TAS	8069912
GO:0010591	Process	Regulation of lamellipodium assembly	IGI	8625410
GO:0012506	Component	Vesicle membrane	IEA
GO:0015629	Component	Actin cytoskeleton	TAS	8625410
GO:0016020	Component	Membrane	IEA
GO:0016197	Process	Endosomal transport	IEA
GO:0017124	Function	SH3 domain binding	IPI	8892607, 19798448
GO:0019901	Function	Protein kinase binding	IPI	8892607
GO:0030041	Process	Actin filament polymerization	IDA	29925947
GO:0030041	Process	Actin filament polymerization	IEA
GO:0030041	Process	Actin filament polymerization	IEA
GO:0030048	Process	Actin filament-based movement	IEA
GO:0030695	Function	GTPase regulator activity	TAS	8625410
GO:0031267	Function	Small GTPase binding	IPI	8625410, 10724160
GO:0032488	Process	Cdc42 protein signal transduction	IMP	8625410
GO:0035861	Component	Site of double-strand break	IDA	29925947
GO:0042110	Process	T cell activation	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	10724160, 12769847, 18650809
GO:0043274	Function	Phospholipase binding	IPI	8892607
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	20574068
GO:0051492	Process	Regulation of stress fiber assembly	IGI	8625410
GO:0051497	Process	Negative regulation of stress fiber assembly	IMP	8625410
GO:0065003	Process	Protein-containing complex assembly	TAS	8625410
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0071346	Process	Cellular response to type II interferon	IEA
GO:1905168	Process	Positive regulation of double-strand break repair via homologous recombination	IDA	29925947
GO:2000146	Process	Negative regulation of cell motility	IMP	22804504
GO:2001032	Process	Regulation of double-strand break repair via nonhomologous end joining	IDA	29925947

MIM	HGNC	e!Ensembl
300392	12731	ENSG00000015285

P42768

Protein name

Actin nucleation-promoting factor WAS (Wiskott-Aldrich syndrome protein) (WASp)

Protein function

Effector protein for Rho-type GTPases that regulates actin filament reorganization via its interaction with the Arp2/3 complex (PubMed:12235133, PubMed:12769847, PubMed:16275905). Important for efficient actin polymerization (PubMed:12235133, Pu

PDB

1CEE , 1EJ5 , 1T84 , 2A3Z , 2K42 , 2OT0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00568	WH1	36 → 145	WH1 domain	Domain
PF00786	PBD	237 → 296	P21-Rho-binding domain	Domain
PF02205	WH2	427 → 454	WH2 motif	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed predominantly in the thymus. Also found, to a much lesser extent, in the spleen. {ECO:0000269|PubMed:8069912}.

Sequence

MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGD
DCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPPTPANEERRGGLPPLPLH
PGGDQGGPPVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQEPLPPPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPP
PPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALV
PAGGLAPGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQSSEGLVGALMHVMQKRSRA
IHSSDEGEDQAGDEDEDDEWDD

Sequence length

502

Interactions

View interactions

	KEGG		Reactome
	Chemokine signaling pathway Adherens junction Tight junction Fc gamma R-mediated phagocytosis Yersinia infection Choline metabolism in cancer		Generation of second messenger molecules Regulation of actin dynamics for phagocytic cup formation RHO GTPases Activate WASPs and WAVEs FCGR3A-mediated phagocytosis

1684

Show/Hide Causal Diseases (11)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Abnormality of blood and blood-forming tissues	Likely pathogenic	rs2147266958	RCV001814436
Colon adenocarcinoma	Pathogenic	rs1057517845	RCV005900671
Thrombocytopenia	Pathogenic; Likely pathogenic	rs2147265894, rs2519289013, rs132630273	RCV002280913 RCV002280981 RCV000851684
Thrombocytopenia 1	Likely pathogenic; Pathogenic	rs2147262951, rs2147264299, rs2147264981, rs2147265693, rs2147265917, rs2147267350, rs2147262855, rs2147265717, rs2147266474, rs2147262809, rs2147263882, rs2147266379, rs2147263906, rs2147267240, rs2519281309 View all (78 more)	RCV001379030 RCV001387982 RCV001390444 RCV001386341 RCV001387588 RCV001387958 RCV002542702 RCV001959541 RCV001950664 RCV001904777 RCV002004114 RCV001952206 RCV001928082 RCV002012548 RCV002308506 RCV003775557 RCV003064718 RCV003041444 RCV003041445 RCV003041446 RCV003064719 RCV003050613 RCV003061641 RCV002829716 RCV002825499 RCV002880962 RCV002898681 RCV002871544 RCV002852854 RCV002872630 RCV003021236 RCV003013605 RCV003027190 RCV003042620 RCV003051659 RCV003779810 RCV000589566 RCV000633305 RCV000011865 RCV000011866 RCV000011867 RCV003764558 RCV000011872 RCV001851800 RCV001225126 RCV003783760 RCV003783763 RCV003783764 RCV003783766 RCV003783767 RCV003797908 RCV003813598 RCV003801681 RCV003807543 RCV003804998 RCV005220798 RCV000461952 RCV001390443 RCV003766237 RCV003764631 RCV001058962 RCV005222958 RCV001038563 RCV001387957 RCV000818878 RCV001230612 RCV000588019 RCV001009627 RCV000633306 RCV000633307 RCV000696288 RCV000700442 RCV005213406 RCV000818272 RCV000797025 RCV000802424 RCV000794890 RCV000808153 RCV000812978 RCV000821672 RCV001029840 RCV001046712 RCV001035433 RCV001047233 RCV001058741 RCV001069236 RCV001058410 RCV001067557 RCV001041620 RCV001216267 RCV001219012 RCV001221529 RCV001220386 RCV001204405 RCV001205113 RCV001385415 RCV005225346
THROMBOCYTOPENIA, X-LINKED, INTERMITTENT	Pathogenic	rs132630275, rs132630276	RCV000011875 RCV000011876
Thyroid cancer, nonmedullary, 1	Pathogenic	rs1064793974	RCV005899645
WAS-related disorder	Pathogenic; Likely pathogenic	rs132630273, rs2519289166, rs387906717, rs11545907, rs2062412810	RCV004748516 RCV003934432 RCV003932228 RCV003407355 RCV003908449 RCV003938561
Wiskott-Aldrich syndrome	Likely pathogenic; Pathogenic	rs1557006534, rs2147262951, rs2147264299, rs2147264981, rs2147265693, rs2147265917, rs2147267350, rs2147264989, rs2147266405, rs2147266326, rs2147262855, rs2147265717, rs2147266474, rs2147262809, rs2147263882 View all (107 more)	RCV001332389 RCV001379030 RCV001387982 RCV001390444 RCV001386341 RCV001387588 RCV001387958 RCV002463367 RCV001706762 RCV001779410 RCV002542702 RCV001959541 RCV001950664 RCV001904777 RCV002004114 RCV001952206 RCV001928082 RCV002012548 RCV002052149 RCV002243549 RCV002245338 RCV002245412 RCV002283681 RCV002290121 RCV003775557 RCV003064718 RCV003041444 RCV003041445 RCV003041446 RCV003064719 RCV003050613 RCV003061641 RCV002829716 RCV002825499 RCV002880962 RCV002898681 RCV002871544 RCV002852854 RCV002872630 RCV003021236 RCV003013605 RCV003027190 RCV003042620 RCV003051659 RCV003130915 RCV003152995 RCV003219202 RCV003226667 RCV000768136 RCV000011862 RCV000011863 RCV000011864 RCV003764557 RCV000011868 RCV000011869 RCV000011870 RCV001037597 RCV000011873 RCV001851800 RCV000011880 RCV000011881 RCV000011882 RCV000011883 RCV003315489 RCV003340995 RCV003783760 RCV003783763 RCV003783764 RCV003783766 RCV003783767 RCV003797908 RCV003813598 RCV003801681 RCV003807543 RCV003804998 RCV005220798 RCV004587791 RCV000461952 RCV001390443 RCV001174594 RCV003764631 RCV001058962 RCV005222958 RCV000780796 RCV001387957 RCV000818878 RCV000030594 RCV000030595 RCV000030597 RCV000586443 RCV000586328 RCV000589073 RCV001056670 RCV000633306 RCV000633307 RCV000714956 RCV000696288 RCV000700442 RCV000780795 RCV000791261 RCV000791259 RCV000791260 RCV000818272 RCV000797025 RCV000802424 RCV000794890 RCV000808153 RCV000812978 RCV000821672 RCV001171382 RCV001171383 RCV001046712 RCV001035433 RCV001047233 RCV001058741 RCV001069236 RCV001058410 RCV001067557 RCV001041620 RCV001090058 RCV001194215 RCV001216267 RCV001219012 RCV001221529 RCV001220386 RCV001204405 RCV001205113 RCV001255566 RCV005225346
WISKOTT-ALDRICH SYNDROME, ATTENUATED	Likely pathogenic	rs132630272	RCV000011871
X-Linked Neutropenia	Likely pathogenic; Pathogenic	rs387906717	RCV004782021
X-linked severe congenital neutropenia	Likely pathogenic; Pathogenic	rs2147262951, rs2147264299, rs2147264981, rs2147265693, rs2147265917, rs2147267350, rs2147262855, rs2147265717, rs2147266474, rs2147262809, rs2147263882, rs2147266379, rs2147263906, rs2147267240, rs2147262851 View all (76 more)	RCV001379030 RCV001387982 RCV001390444 RCV001386341 RCV001387588 RCV001387958 RCV002542702 RCV001959541 RCV001950664 RCV001904777 RCV002004114 RCV001952206 RCV001928082 RCV002012548 RCV002246812 RCV003775557 RCV003064718 RCV003041444 RCV003041445 RCV003041446 RCV003064719 RCV003050613 RCV003061641 RCV002829716 RCV002825499 RCV002880962 RCV002898681 RCV002871544 RCV002852854 RCV002872630 RCV003021236 RCV003013605 RCV003027190 RCV003042620 RCV003051659 RCV003159554 RCV003779810 RCV000768136 RCV000633305 RCV003764557 RCV003764558 RCV001037597 RCV000011874 RCV001225126 RCV003783760 RCV003783763 RCV003783764 RCV003783766 RCV003783767 RCV003797908 RCV003813598 RCV003801681 RCV003807543 RCV003804998 RCV005220798 RCV000461952 RCV001390443 RCV003766237 RCV000022858 RCV000022859 RCV005222958 RCV001038563 RCV001387957 RCV000818878 RCV000990812 RCV001230612 RCV001056670 RCV000633306 RCV000633307 RCV000696288 RCV000700442 RCV005213406 RCV000818272 RCV000797025 RCV000802424 RCV000794890 RCV000808153 RCV000812978 RCV000821672 RCV000990811 RCV001046712 RCV001035433 RCV001047233 RCV001058741 RCV001069236 RCV001058410 RCV001067557 RCV001041620 RCV001216267 RCV001219012 RCV001221529 RCV001220386 RCV001204405 RCV001205113 RCV001385415 RCV001280623

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Abnormal bleeding	Uncertain significance	rs2062438405	RCV001270616

Show/Hide Text Mining Associations (52)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acquired Immunodeficiency Syndrome	Associate	9024694
Anemia Hemolytic Autoimmune	Associate	31354712
Arthritis Rheumatoid	Associate	40048636
Autoimmune Diseases	Associate	24872192, 31354712, 37478401
Bacterial Infections	Associate	12969986
Blast Crisis	Inhibit	29022901
Blood Platelet Disorders	Associate	10397718, 9376590
Bruton type agammaglobulinemia	Associate	10590061, 10688822, 22927353, 30564228
Carcinogenesis	Inhibit	29022901
Carcinoma Renal Cell	Associate	37122750
Cerebral Infarction	Associate	38575196
Colorectal Neoplasms	Associate	37950620
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	16709815
COVID 19	Associate	33329599, 36052061
Death	Associate	12969986, 22523910
Dermatitis Atopic	Associate	11800140
Eczema	Associate	11800140, 12969986, 24369837, 29358862
Eczema	Inhibit	37478401
Glomerulonephritis IGA	Associate	31354712
Hemorrhagic Disorders	Associate	37478401
Immunologic Deficiency Syndromes	Associate	10512884, 10590061, 24369837, 26261240, 29248492, 9376590
Infections	Associate	12743306, 16709815
Inflammation	Associate	26261240
Inflammatory Bowel Diseases	Associate	29358862
Intestinal Diseases	Associate	12969986
Intracranial Hemorrhages	Associate	12969986
Leukemia Myelogenous Chronic BCR ABL Positive	Inhibit	29022901
Metabolic Diseases	Associate	33135633
Mycoses	Associate	12969986
Neoplasms	Associate	12969986, 29022901, 29248492, 29845225, 37122750, 37950620
Neoplasms	Stimulate	24369837
Neural Tube Defects	Associate	20354175
Neuropathy Hereditary Sensory X Linked	Associate	17312144
Neutropenia Severe Congenital Autosomal Recessive 3	Associate	21891829, 23454784
Neutropenia Severe Congenital X Linked	Associate	11877312, 19006568, 25200405
Neutropenia Severe Congenital X Linked	Stimulate	29248492
Pneumocystis Infections	Associate	12969986
Primary Immunodeficiency Diseases	Associate	10449748, 12177428, 22927353, 30564228, 32503528
Purpura Thrombocytopenic Idiopathic	Associate	31354712
Rare Diseases	Associate	27643436
Retinoblastoma	Associate	34187205
Severe Combined Immunodeficiency	Associate	22927353, 30564228
Skin Manifestations	Associate	24369837
Subarachnoid Hemorrhage	Associate	12969986
Thrombocytopenia	Associate	10590061, 11877312, 26502776
Thrombocytopenia	Stimulate	32503528
Thrombocytopenia 1	Associate	10583210, 11877312, 12969986, 15001467, 15284122, 20130240, 25200405, 25253772, 26277674, 29358862, 9616151
Venom Hypersensitivity	Associate	26368308
Wiskott Aldrich Syndrome	Associate	10449748, 10572103, 10590061, 10706671, 11290809, 11313252, 11442475, 11877312, 12135674, 12149199, 12196287, 12969986, 15030520, 15985539, 16582881 View all (33 more)
Wiskott Aldrich Syndrome	Stimulate	15284122
Wiskott Aldrich Syndrome	Inhibit	17890224
X Linked Combined Immunodeficiency Diseases	Associate	24872192

WAS (WASP actin nucleation promoting factor)