VTN (vitronectin)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 7448
Gene name Vitronectin
Gene symbol VTN
Synonyms (NCBI Gene)
V75VNVNT
Chromosome 17
Chromosome location 17q11.2
Summary The protein encoded by this gene functions in part as an adhesive glycoprotein. Differential expression of this protein can promote either cell adhesion or migration as it links cells to the extracellular matrix through a variety of ligands. These ligands
miRNA miRNA information provided by mirtarbase database.
2
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (2)
miRTarBase ID miRNA Experiments Reference
MIRT018592 hsa-miR-335-5p Microarray 18185580
MIRT029971 hsa-miR-26b-5p Microarray 19088304
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
71
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (71)
GO ID Ontology Definition Evidence Reference
GO:0005044 Function Scavenger receptor activity IEA
GO:0005178 Function Integrin binding IBA
GO:0005178 Function Integrin binding IDA 22505472
GO:0005178 Function Integrin binding IPI 8837777
GO:0005201 Function Extracellular matrix structural constituent ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
193190 12724 ENSG00000109072
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P04004
Protein name Vitronectin (VN) (S-protein) (Serum-spreading factor) (V75) [Cleaved into: Vitronectin V65 subunit; Vitronectin V10 subunit; Somatomedin-B]
Protein function Vitronectin is a cell adhesion and spreading factor found in serum and tissues. Vitronectin interact with glycosaminoglycans and proteoglycans. Is recognized by certain members of the integrin family and serves as a cell-to-substrate adhesion mo
PDB 1OC0 , 1S4G , 1SSU , 2JQ8 , 3BT1 , 3BT2 , 4K24 , 6O5E , 7RJ9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01033 Somatomedin_B 22 → 61 Somatomedin B domain Family
PF00045 Hemopexin 161 → 204 Hemopexin Repeat
PF00045 Hemopexin 206 → 252 Hemopexin Repeat
PF00045 Hemopexin 254 → 304 Hemopexin Repeat
PF00045 Hemopexin 425 → 472 Hemopexin Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed in the retina pigment epithelium (at protein level) (PubMed:25136834). Expressed in plasma (at protein level) (PubMed:2448300). Expressed in serum (at protein level) (PubMed:29567995). {ECO:0000269|PubMed:2448300, ECO:0000269
Sequence 
MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKP
QVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEE
EAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYC
YELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYP
RNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSA
VFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMA
PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDY
RMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
Sequence length 478
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Complement and coagulation cascades
Human papillomavirus infection
Proteoglycans in cancer 		  Molecules associated with elastic fibres
Integrin cell surface interactions
Syndecan interactions
ECM proteoglycans
Regulation of Complement cascade
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
13
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
VTN-related disorder Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity rs527927776, rs994071377, rs2227725, rs782574804, rs2227728, rs704, rs782306878, rs35339100, rs376564388, rs2227723, rs34134929, rs112887300, rs374231917 RCV003412058
RCV003427905
RCV003974405
RCV003894447
RCV003979638
RCV003979735
RCV003899751
RCV003964410
RCV003971878
RCV003932308
RCV003897942
RCV003940794
RCV003970607
Show/Hide Text Mining Associations (116)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Coronary Syndrome Stimulate 33672727
Acute Coronary Syndrome Associate 34002800
Aortic Aneurysm Abdominal Associate 19038529
Apraxias Inhibit 24015209
Asthma Inhibit 25768308
Atrial Fibrillation Associate 32389013
Atypical Hemolytic Uremic Syndrome Associate 30377230
beta Thalassemia Inhibit 37939833
Bone Diseases Associate 21362709
Brain Concussion Associate 36834989