Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7448
Gene name Gene Name - the full gene name approved by the HGNC.
Vitronectin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
VTN
Synonyms (NCBI Gene) Gene synonyms aliases
V75, VN, VNT
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q11.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene functions in part as an adhesive glycoprotein. Differential expression of this protein can promote either cell adhesion or migration as it links cells to the extracellular matrix through a variety of ligands. These ligands
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018592 hsa-miR-335-5p Microarray 18185580
MIRT029971 hsa-miR-26b-5p Microarray 19088304
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005044 Function Scavenger receptor activity IEA
GO:0005178 Function Integrin binding IBA
GO:0005178 Function Integrin binding IDA 22505472
GO:0005178 Function Integrin binding IPI 8837777
GO:0005201 Function Extracellular matrix structural constituent ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
193190 12724 ENSG00000109072
Protein
UniProt ID P04004
Protein name Vitronectin (VN) (S-protein) (Serum-spreading factor) (V75) [Cleaved into: Vitronectin V65 subunit; Vitronectin V10 subunit; Somatomedin-B]
Protein function Vitronectin is a cell adhesion and spreading factor found in serum and tissues. Vitronectin interact with glycosaminoglycans and proteoglycans. Is recognized by certain members of the integrin family and serves as a cell-to-substrate adhesion mo
PDB 1OC0 , 1S4G , 1SSU , 2JQ8 , 3BT1 , 3BT2 , 4K24 , 6O5E , 7RJ9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01033 Somatomedin_B 22 61 Somatomedin B domain Family
PF00045 Hemopexin 161 204 Hemopexin Repeat
PF00045 Hemopexin 206 252 Hemopexin Repeat
PF00045 Hemopexin 254 304 Hemopexin Repeat
PF00045 Hemopexin 425 472 Hemopexin Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed in the retina pigment epithelium (at protein level) (PubMed:25136834). Expressed in plasma (at protein level) (PubMed:2448300). Expressed in serum (at protein level) (PubMed:29567995). {ECO:0000269|PubMed:2448300, ECO:0000269
Sequence
MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKP
Q
VTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEE
EAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYC
YELDEKAVRPGYPKLIRDVWGIEG
PIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYP
RNISDGFDGIPD
NVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSA
VFEH
FAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMA
PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDY
RMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
Sequence length 478
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Complement and coagulation cascades
Human papillomavirus infection
Proteoglycans in cancer
  Molecules associated with elastic fibres
Integrin cell surface interactions
Syndecan interactions
ECM proteoglycans
Regulation of Complement cascade
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Triglyceride levels in non-type 2 diabetes N/A N/A GWAS
Giant Cell Arteritis Giant cell arteritis N/A N/A GWAS
Hypertension Hypertension N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute Coronary Syndrome Stimulate 33672727
Acute Coronary Syndrome Associate 34002800
Aortic Aneurysm Abdominal Associate 19038529
Apraxias Inhibit 24015209
Asthma Inhibit 25768308
Atrial Fibrillation Associate 32389013
Atypical Hemolytic Uremic Syndrome Associate 30377230
beta Thalassemia Inhibit 37939833
Bone Diseases Associate 21362709
Brain Concussion Associate 36834989