Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7447
Gene name Gene Name - the full gene name approved by the HGNC.	Visinin like 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	VSNL1
Synonyms (NCBI Gene) Gene synonyms aliases	HLP3, HPCAL3, HUVISL1, VILIP, VILIP-1
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2p24.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the visinin/recoverin subfamily of neuronal calcium sensor proteins. The encoded protein is strongly expressed in granule cells of the cerebellum where it associates with membranes in a calcium-dependent manner and modulates intra

Show/Hide all(98)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003036	hsa-miR-181b-5p	Luciferase assay/RT-PCR	18184693
MIRT003036	hsa-miR-181b-5p	Luciferase reporter assay	18184693
MIRT003036	hsa-miR-181b-5p	Reporter assay;Other	18184693
MIRT721306	hsa-miR-518e-3p	HITS-CLIP	19536157
MIRT721305	hsa-miR-6873-5p	HITS-CLIP	19536157
MIRT721304	hsa-miR-520g-5p	HITS-CLIP	19536157
MIRT721303	hsa-miR-5087	HITS-CLIP	19536157
MIRT721302	hsa-miR-8068	HITS-CLIP	19536157
MIRT721301	hsa-miR-587	HITS-CLIP	19536157
MIRT552906	hsa-miR-22-3p	HITS-CLIP	23824327
MIRT552905	hsa-miR-1257	HITS-CLIP	23824327
MIRT552904	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT449351	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT552902	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT552903	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT607625	hsa-miR-3942-5p	HITS-CLIP	24906430
MIRT607624	hsa-miR-4703-5p	HITS-CLIP	24906430
MIRT607623	hsa-miR-16-2-3p	HITS-CLIP	24906430
MIRT607622	hsa-miR-195-3p	HITS-CLIP	24906430
MIRT552904	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT552902	hsa-miR-6818-5p	HITS-CLIP	24906430
MIRT607621	hsa-miR-147a	HITS-CLIP	24906430
MIRT607620	hsa-miR-5010-3p	HITS-CLIP	24906430
MIRT552903	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT552906	hsa-miR-22-3p	PAR-CLIP	20371350
MIRT552905	hsa-miR-1257	PAR-CLIP	20371350
MIRT552904	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT449351	hsa-miR-5585-3p	PAR-CLIP	20371350
MIRT552902	hsa-miR-6818-5p	PAR-CLIP	20371350
MIRT552903	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT552906	hsa-miR-22-3p	PAR-CLIP	21572407
MIRT552905	hsa-miR-1257	PAR-CLIP	21572407
MIRT552904	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT449351	hsa-miR-5585-3p	PAR-CLIP	21572407
MIRT552902	hsa-miR-6818-5p	PAR-CLIP	21572407
MIRT552903	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT449356	hsa-miR-548n	PAR-CLIP	22100165
MIRT449354	hsa-miR-548av-5p	PAR-CLIP	22100165
MIRT449353	hsa-miR-548k	PAR-CLIP	22100165
MIRT449352	hsa-miR-8054	PAR-CLIP	22100165
MIRT449351	hsa-miR-5585-3p	PAR-CLIP	22100165
MIRT449350	hsa-miR-3161	PAR-CLIP	22100165
MIRT449349	hsa-miR-599	PAR-CLIP	22100165
MIRT552905	hsa-miR-1257	HITS-CLIP	27418678
MIRT552905	hsa-miR-1257	HITS-CLIP	27418678
MIRT607621	hsa-miR-147a	HITS-CLIP	27418678
MIRT552906	hsa-miR-22-3p	HITS-CLIP	27418678
MIRT552906	hsa-miR-22-3p	HITS-CLIP	27418678
MIRT607620	hsa-miR-5010-3p	HITS-CLIP	27418678
MIRT449351	hsa-miR-5585-3p	HITS-CLIP	27418678
MIRT449351	hsa-miR-5585-3p	HITS-CLIP	27418678
MIRT552903	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT552902	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT552904	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT721306	hsa-miR-518e-3p	HITS-CLIP	19536157
MIRT721305	hsa-miR-6873-5p	HITS-CLIP	19536157
MIRT721304	hsa-miR-520g-5p	HITS-CLIP	19536157
MIRT721303	hsa-miR-5087	HITS-CLIP	19536157
MIRT721302	hsa-miR-8068	HITS-CLIP	19536157
MIRT721301	hsa-miR-587	HITS-CLIP	19536157
MIRT552906	hsa-miR-22-3p	HITS-CLIP	23824327
MIRT552905	hsa-miR-1257	HITS-CLIP	23824327
MIRT552904	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT449351	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT552902	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT552903	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT552906	hsa-miR-22-3p	PAR-CLIP	20371350
MIRT552905	hsa-miR-1257	PAR-CLIP	20371350
MIRT552904	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT449351	hsa-miR-5585-3p	PAR-CLIP	20371350
MIRT552902	hsa-miR-6818-5p	PAR-CLIP	20371350
MIRT552903	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT552906	hsa-miR-22-3p	PAR-CLIP	21572407
MIRT552905	hsa-miR-1257	PAR-CLIP	21572407
MIRT552904	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT449351	hsa-miR-5585-3p	PAR-CLIP	21572407
MIRT552902	hsa-miR-6818-5p	PAR-CLIP	21572407
MIRT552903	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT449356	hsa-miR-548n	PAR-CLIP	22100165
MIRT449354	hsa-miR-548av-5p	PAR-CLIP	22100165
MIRT449353	hsa-miR-548k	PAR-CLIP	22100165
MIRT449352	hsa-miR-8054	PAR-CLIP	22100165
MIRT449351	hsa-miR-5585-3p	PAR-CLIP	22100165
MIRT449350	hsa-miR-3161	PAR-CLIP	22100165
MIRT449349	hsa-miR-599	PAR-CLIP	22100165
MIRT1487861	hsa-miR-3064-3p	CLIP-seq
MIRT1487862	hsa-miR-4715-3p	CLIP-seq
MIRT1487863	hsa-miR-671-5p	CLIP-seq
MIRT2146805	hsa-miR-147	CLIP-seq
MIRT2146806	hsa-miR-3659	CLIP-seq
MIRT2146807	hsa-miR-4731-3p	CLIP-seq
MIRT2146808	hsa-miR-4801	CLIP-seq
MIRT2146809	hsa-miR-607	CLIP-seq
MIRT2146805	hsa-miR-147	CLIP-seq
MIRT2463337	hsa-miR-217	CLIP-seq
MIRT2463338	hsa-miR-4418	CLIP-seq
MIRT2463339	hsa-miR-509-3-5p	CLIP-seq
MIRT2463340	hsa-miR-509-5p	CLIP-seq

Show/Hide all(7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 16713569, 25416956, 32296183, 32814053
GO:0005829	Component	Cytosol	IEA
GO:0016020	Component	Membrane	IEA
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0045921	Process	Positive regulation of exocytosis	IEA
GO:0046676	Process	Negative regulation of insulin secretion	IEA

MIM	HGNC	e!Ensembl
600817	12722	ENSG00000163032

Protein

UniProt ID

P62760

Protein name

Visinin-like protein 1 (VILIP) (VLP-1) (Hippocalcin-like protein 3) (HLP3)

Protein function

Regulates (in vitro) the inhibition of rhodopsin phosphorylation in a calcium-dependent manner.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00036	EF-hand_1	64 → 92	EF hand	Domain
PF13499	EF-hand_7	98 → 176	EF-hand domain pair	Domain
PF00036	EF-hand_1	100 → 128	EF hand	Domain

Tissue specificity

TISSUE SPECIFICITY: Brain and retina. Neuron-specific in the central and peripheral nervous system. Increased in the cerebrospinal fluid of Alzheimer disease patients (at protein level). {ECO:0000269|PubMed:18703769}.

Sequence

MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGD
ASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVE
MLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPS
IVLLLQCDIQK

Sequence length

191

Interactions

View interactions

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Alzheimer disease	Familial Alzheimer Disease (FAD), Alzheimer Disease, Late Onset, Alzheimer Disease, Early Onset, Alzheimer`s Disease, Alzheimer`s Disease, Focal Onset	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039 View all (65 more)	25806004, 22005930
Diabetes mellitus	Diabetes Mellitus, Non-Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)	29221444
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	22832524, 18184693

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Psoriasis	Psoriasis			GWAS

Show/Hide Text Mining Associations (32)

Disease Name	Relationship Type	References
Associations from Text Mining
AA amyloidosis	Associate	30846386
Adrenocortical Carcinoma	Associate	35185794
Alzheimer Disease	Stimulate	18703769, 36419075
Alzheimer Disease	Associate	26517091, 26769253, 30329219, 30846386
Atrial Fibrillation	Associate	37960721
Brain Injuries	Associate	18703769
Carcinoma Non Small Cell Lung	Inhibit	18301774
Carcinoma Squamous Cell	Inhibit	18301774
Cognition Disorders	Associate	24598588
Colorectal Neoplasms	Associate	37096864, 37535601
Creutzfeldt Jakob Syndrome	Stimulate	36419075
Dementia	Associate	26517091
Diffuse Neurofibrillary Tangles with Calcification	Associate	24598588
Down Syndrome	Associate	34302786
Epilepsy	Associate	38203674
Frontotemporal Lobar Degeneration	Associate	26517091, 26769253
Glioblastoma	Associate	26683098, 32510239
Hyperaldosteronism	Associate	35185794
Lewy Body Disease	Associate	26517091
Lung Neoplasms	Associate	18301774
Mental Disorders	Associate	38203674
Neoplasms	Inhibit	18301774
Neoplasms	Associate	40420762
Nerve Degeneration	Associate	24598588, 26769253, 30846386
Neu Laxova syndrome	Associate	36216277
Neurodegenerative Diseases	Associate	36419075
Neuroinflammatory Diseases	Associate	30846386
Osteoarthritis Knee	Associate	36216277
Paraganglioma	Associate	40420762
Retrograde Degeneration	Associate	30846386
Sleep Apnea Obstructive	Associate	39836940
Stomach Neoplasms	Associate	35595817

VSNL1 (visinin like 1)