Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7447
Gene name Gene Name - the full gene name approved by the HGNC.
Visinin like 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
VSNL1
Synonyms (NCBI Gene) Gene synonyms aliases
HLP3, HPCAL3, HUVISL1, VILIP, VILIP-1
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p24.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the visinin/recoverin subfamily of neuronal calcium sensor proteins. The encoded protein is strongly expressed in granule cells of the cerebellum where it associates with membranes in a calcium-dependent manner and modulates intra
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003036 hsa-miR-181b-5p Luciferase assay/RT-PCR 18184693
MIRT003036 hsa-miR-181b-5p Luciferase reporter assay 18184693
MIRT003036 hsa-miR-181b-5p Reporter assay;Other 18184693
MIRT721306 hsa-miR-518e-3p HITS-CLIP 19536157
MIRT721305 hsa-miR-6873-5p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 16189514, 16713569, 25416956, 32296183, 32814053
GO:0005829 Component Cytosol IEA
GO:0009966 Process Regulation of signal transduction IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600817 12722 ENSG00000163032
Protein
UniProt ID P62760
Protein name Visinin-like protein 1 (VILIP) (VLP-1) (Hippocalcin-like protein 3) (HLP3)
Protein function Regulates (in vitro) the inhibition of rhodopsin phosphorylation in a calcium-dependent manner.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00036 EF-hand_1 64 92 EF hand Domain
PF13499 EF-hand_7 98 176 EF-hand domain pair Domain
PF00036 EF-hand_1 100 128 EF hand Domain
Tissue specificity TISSUE SPECIFICITY: Brain and retina. Neuron-specific in the central and peripheral nervous system. Increased in the cerebrospinal fluid of Alzheimer disease patients (at protein level). {ECO:0000269|PubMed:18703769}.
Sequence
MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGD
ASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVE
MLEIIEAI
YKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAK
SDPS
IVLLLQCDIQK
Sequence length 191
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Psoriasis Psoriasis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
AA amyloidosis Associate 30846386
Adrenocortical Carcinoma Associate 35185794
Alzheimer Disease Stimulate 18703769, 36419075
Alzheimer Disease Associate 26517091, 26769253, 30329219, 30846386
Atrial Fibrillation Associate 37960721
Brain Injuries Associate 18703769
Carcinoma Non Small Cell Lung Inhibit 18301774
Carcinoma Squamous Cell Inhibit 18301774
Cognition Disorders Associate 24598588
Colorectal Neoplasms Associate 37096864, 37535601