Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7444
Gene name Gene Name - the full gene name approved by the HGNC.	VRK serine/threonine kinase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	VRK2
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2p16.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. The encoded protein acts as an effector of signaling pathways that regulate apoptosis and tumor cell growth. Variants in this gene have been associ

Show/Hide all(19)

miRTarBase ID	miRNA	Experiments
MIRT1487504	hsa-miR-2053	CLIP-seq
MIRT1487505	hsa-miR-2117	CLIP-seq
MIRT1487506	hsa-miR-4273	CLIP-seq
MIRT1487507	hsa-miR-4753-3p	CLIP-seq
MIRT2367274	hsa-miR-3117-5p	CLIP-seq
MIRT2367275	hsa-miR-325	CLIP-seq
MIRT2367276	hsa-miR-330-3p	CLIP-seq
MIRT2367277	hsa-miR-425	CLIP-seq
MIRT2367278	hsa-miR-520d-5p	CLIP-seq
MIRT2367279	hsa-miR-524-5p	CLIP-seq
MIRT2367280	hsa-miR-628-3p	CLIP-seq
MIRT2463328	hsa-miR-4261	CLIP-seq
MIRT2463329	hsa-miR-4487	CLIP-seq
MIRT2463330	hsa-miR-4709-3p	CLIP-seq
MIRT2463331	hsa-miR-875-3p	CLIP-seq
MIRT2463328	hsa-miR-4261	CLIP-seq
MIRT2463329	hsa-miR-4487	CLIP-seq
MIRT2463330	hsa-miR-4709-3p	CLIP-seq
MIRT2463331	hsa-miR-875-3p	CLIP-seq

Show/Hide all(38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	14645249, 16495336, 16704422
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	9344656
GO:0005515	Function	Protein binding	IPI	16963744, 17709393, 18286207, 18617507, 20679487, 22752157, 23105117, 23449449, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16704422
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IEA
GO:0005635	Component	Nuclear envelope	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	16704422
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	22572157
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	18286207
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006468	Process	Protein phosphorylation	TAS	9344656
GO:0006974	Process	DNA damage response	IBA
GO:0007165	Process	Signal transduction	IBA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019901	Function	Protein kinase binding	IDA	22572157
GO:0019904	Function	Protein domain specific binding	IDA	22572157
GO:0031966	Component	Mitochondrial membrane	IDA	18286207
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0031967	Component	Organelle envelope	IEA
GO:0032991	Component	Protein-containing complex	IDA	22572157
GO:0034599	Process	Cellular response to oxidative stress	IMP	17709393
GO:0043408	Process	Regulation of MAPK cascade	IMP	20679487
GO:0046777	Process	Protein autophosphorylation	IDA	14645249, 16704422
GO:0106310	Function	Protein serine kinase activity	IEA
GO:2000659	Process	Regulation of interleukin-1-mediated signaling pathway	IMP	18286207

MIM	HGNC	e!Ensembl
602169	12719	ENSG00000028116

Protein

UniProt ID

Q86Y07

Protein name

Serine/threonine-protein kinase VRK2 (EC 2.7.11.1) (Vaccinia-related kinase 2)

Protein function

Serine/threonine kinase that regulates several signal transduction pathways (PubMed:14645249, PubMed:16495336, PubMed:16704422, PubMed:17709393, PubMed:18286207, PubMed:18617507, PubMed:20679487). Isoform 1 modulates the stress response to hypox

PDB

2V62 , 5UU1 , 6NCG , 8Q1Z , 9FET

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	29 → 311	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 and isoform 2 are expressed in various tumor cell lines. Expression of isoform 1 inversely correlates with ERBB2 in breast carcinomas (at protein level). Widely expressed. Highly expressed in fetal liver, skeletal muscle, pan

Sequence

MPPKRNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVV
KVEYQENGPLFSELKFYQRVAKKDCIKKWIERKQLDYLGIPLFYGSGLTEFKGRSYRFMV
MERLGIDLQKISGQNGTFKKSTVLQLGIRMLDVLEYIHENEYVHGDIKAANLLLGYKNPD
QVYLADYGLSYRYCPNGNHKQYQENPRKGHNGTIEFTSLDAHKGVALSRRSDVEILGYCM
LRWLCGKLPWEQNLKDPVAVQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAY
DEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATKQVNKAHNRLI
EKKVHSERSAESCATWKVQKEEKLIGLMNNEAAQESTRRRQKYQESQEPLNEVNSFPQKI
SYTQFPNSFYEPHQDFTSPDIFKKSRSPSWYKYTSTVSTGITDLESSTGLWPTISQFTLS
EETNADVYYYRIIIPVLLMLVFLALFFL

Sequence length

508

Interactions

View interactions

	Reactome
			Nuclear Envelope Breakdown Initiation of Nuclear Envelope (NE) Reformation

Show/Hide Unknown Diseases (9)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Astrocytoma	Astrocytoma	N/A	N/A	GWAS
Epilepsy	Epilepsy	N/A	N/A	GWAS
Hirschsprung Disease	Hirschsprung disease	N/A	N/A	GWAS
Mental Depression	Major depressive disorder	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Neuroblastoma	Neuroblastoma	N/A	N/A	GWAS
Neuroticism	Neuroticism	N/A	N/A	GWAS
Prostate cancer	Prostate cancer	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (20)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	27456229
Breast Neoplasms	Associate	20679487, 38186576
Bronchiectasis	Stimulate	40536885
Carcinogenesis	Associate	27456229
Epilepsy	Associate	30185235
Genetic Diseases Inborn	Associate	30122582
Glaucoma Open Angle	Associate	22876139
Glioblastoma	Associate	36069976
Glioma	Associate	36040810
Intellectual Disability	Associate	30122582
Malformations of Cortical Development	Associate	20799320
Nasopharyngeal Carcinoma	Associate	35509856
Neoplasms	Inhibit	20679487
Neoplasms	Associate	22876139, 27456229, 28790404, 32959881, 36040810, 38186576
Neuroblastoma	Associate	36040810
Neurodegenerative Diseases	Associate	25755282
Neuroinflammatory Diseases	Associate	39745514
Respiratory System Abnormalities	Associate	36040810
Schizophrenia	Associate	25079070
Sleep Initiation and Maintenance Disorders	Associate	39745514

VRK2 (VRK serine/threonine kinase 2)