VRK2 (VRK serine/threonine kinase 2)

Gene

• Entrez ID: 7444
• Gene name: VRK serine/threonine kinase 2
• Gene symbol: VRK2
• Synonyms (NCBI Gene): -
• Chromosome: 2
• Chromosome location: 2p16.1
• Summary: This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. The encoded protein acts as an effector of signaling pathways that regulate apoptosis and tumor cell growth. Variants in this gene have been associ

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1487504	hsa-miR-2053	CLIP-seq
MIRT1487505	hsa-miR-2117	CLIP-seq
MIRT1487506	hsa-miR-4273	CLIP-seq
MIRT1487507	hsa-miR-4753-3p	CLIP-seq
MIRT2367274	hsa-miR-3117-5p	CLIP-seq
MIRT2367275	hsa-miR-325	CLIP-seq
MIRT2367276	hsa-miR-330-3p	CLIP-seq
MIRT2367277	hsa-miR-425	CLIP-seq
MIRT2367278	hsa-miR-520d-5p	CLIP-seq
MIRT2367279	hsa-miR-524-5p	CLIP-seq
MIRT2367280	hsa-miR-628-3p	CLIP-seq
MIRT2463328	hsa-miR-4261	CLIP-seq
MIRT2463329	hsa-miR-4487	CLIP-seq
MIRT2463330	hsa-miR-4709-3p	CLIP-seq
MIRT2463331	hsa-miR-875-3p	CLIP-seq
MIRT2463328	hsa-miR-4261	CLIP-seq
MIRT2463329	hsa-miR-4487	CLIP-seq
MIRT2463330	hsa-miR-4709-3p	CLIP-seq
MIRT2463331	hsa-miR-875-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	14645249, 16495336, 16704422
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	9344656
GO:0005515	Function	Protein binding	IPI	16963744, 17709393, 18286207, 18617507, 20679487, 22752157, 23105117, 23449449, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16704422
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IEA
GO:0005635	Component	Nuclear envelope	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	16704422
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	22572157
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	18286207
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006468	Process	Protein phosphorylation	TAS	9344656
GO:0006974	Process	DNA damage response	IBA
GO:0007165	Process	Signal transduction	IBA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019901	Function	Protein kinase binding	IDA	22572157
GO:0019904	Function	Protein domain specific binding	IDA	22572157
GO:0031966	Component	Mitochondrial membrane	IDA	18286207
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0031967	Component	Organelle envelope	IEA
GO:0032991	Component	Protein-containing complex	IDA	22572157
GO:0034599	Process	Cellular response to oxidative stress	IMP	17709393
GO:0043408	Process	Regulation of MAPK cascade	IMP	20679487
GO:0046777	Process	Protein autophosphorylation	IDA	14645249, 16704422
GO:0106310	Function	Protein serine kinase activity	IEA
GO:2000659	Process	Regulation of interleukin-1-mediated signaling pathway	IMP	18286207

Other IDs

• MIM: 602169
• HGNC: 12719
• e!Ensembl: ENSG00000028116

Protein

• UniProt ID: Q86Y07
• Protein name: Serine/threonine-protein kinase VRK2 (EC 2.7.11.1) (Vaccinia-related kinase 2)
• Protein function: Serine/threonine kinase that regulates several signal transduction pathways (PubMed:14645249, PubMed:16495336, PubMed:16704422, PubMed:17709393, PubMed:18286207, PubMed:18617507, PubMed:20679487). Isoform 1 modulates the stress response to hypox
• PDB: 2V62, 5UU1, 6NCG, 8Q1Z, 9FET
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	29 → 311	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Isoform 1 and isoform 2 are expressed in various tumor cell lines. Expression of isoform 1 inversely correlates with ERBB2 in breast carcinomas (at protein level). Widely expressed. Highly expressed in fetal liver, skeletal muscle, pan
• Sequence:

  MPPKRNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVV
  KVEYQENGPLFSELKFYQRVAKKDCIKKWIERKQLDYLGIPLFYGSGLTEFKGRSYRFMV
  MERLGIDLQKISGQNGTFKKSTVLQLGIRMLDVLEYIHENEYVHGDIKAANLLLGYKNPD
  QVYLADYGLSYRYCPNGNHKQYQENPRKGHNGTIEFTSLDAHKGVALSRRSDVEILGYCM
  LRWLCGKLPWEQNLKDPVAVQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAY
  DEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATKQVNKAHNRLI
  EKKVHSERSAESCATWKVQKEEKLIGLMNNEAAQESTRRRQKYQESQEPLNEVNSFPQKI
  SYTQFPNSFYEPHQDFTSPDIFKKSRSPSWYKYTSTVSTGITDLESSTGLWPTISQFTLS
  EETNADVYYYRIIIPVLLMLVFLALFFL

• Sequence length: 508

Pathways

Reactome:

Nuclear Envelope Breakdown
Initiation of Nuclear Envelope (NE) Reformation