Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7441
Gene name Gene Name - the full gene name approved by the HGNC.	V-set pre-B cell surrogate light chain 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	VPREB1
Synonyms (NCBI Gene) Gene synonyms aliases	CD179a, IGI, IGVPB, VPREB
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q11.22
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the immunoglobulin superfamily and is expressed selectively at the early stages of B cell development, namely, in proB and early preB cells. This gene encodes the iota polypeptide chain that is associated with t

Show/Hide all(53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030217	hsa-miR-26b-5p	Microarray	19088304
MIRT709264	hsa-miR-6865-3p	HITS-CLIP	19536157
MIRT709263	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT709262	hsa-miR-6499-5p	HITS-CLIP	19536157
MIRT709261	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT709260	hsa-miR-3960	HITS-CLIP	19536157
MIRT709259	hsa-miR-8072	HITS-CLIP	19536157
MIRT709258	hsa-miR-4467	HITS-CLIP	19536157
MIRT709257	hsa-miR-5581-3p	HITS-CLIP	19536157
MIRT709256	hsa-miR-3181	HITS-CLIP	19536157
MIRT709255	hsa-miR-4750-5p	HITS-CLIP	19536157
MIRT709254	hsa-miR-3944-3p	HITS-CLIP	19536157
MIRT709264	hsa-miR-6865-3p	HITS-CLIP	19536157
MIRT709263	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT709262	hsa-miR-6499-5p	HITS-CLIP	19536157
MIRT709261	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT709260	hsa-miR-3960	HITS-CLIP	19536157
MIRT709259	hsa-miR-8072	HITS-CLIP	19536157
MIRT709258	hsa-miR-4467	HITS-CLIP	19536157
MIRT709257	hsa-miR-5581-3p	HITS-CLIP	19536157
MIRT709256	hsa-miR-3181	HITS-CLIP	19536157
MIRT709255	hsa-miR-4750-5p	HITS-CLIP	19536157
MIRT709254	hsa-miR-3944-3p	HITS-CLIP	19536157
MIRT709264	hsa-miR-6865-3p	HITS-CLIP	19536157
MIRT709263	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT709262	hsa-miR-6499-5p	HITS-CLIP	19536157
MIRT709261	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT709260	hsa-miR-3960	HITS-CLIP	19536157
MIRT709259	hsa-miR-8072	HITS-CLIP	19536157
MIRT709258	hsa-miR-4467	HITS-CLIP	19536157
MIRT709257	hsa-miR-5581-3p	HITS-CLIP	19536157
MIRT709256	hsa-miR-3181	HITS-CLIP	19536157
MIRT709255	hsa-miR-4750-5p	HITS-CLIP	19536157
MIRT709254	hsa-miR-3944-3p	HITS-CLIP	19536157
MIRT709264	hsa-miR-6865-3p	HITS-CLIP	19536157
MIRT709263	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT709262	hsa-miR-6499-5p	HITS-CLIP	19536157
MIRT709261	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT709260	hsa-miR-3960	HITS-CLIP	19536157
MIRT709259	hsa-miR-8072	HITS-CLIP	19536157
MIRT709258	hsa-miR-4467	HITS-CLIP	19536157
MIRT709257	hsa-miR-5581-3p	HITS-CLIP	19536157
MIRT709256	hsa-miR-3181	HITS-CLIP	19536157
MIRT709255	hsa-miR-4750-5p	HITS-CLIP	19536157
MIRT709254	hsa-miR-3944-3p	HITS-CLIP	19536157
MIRT2146067	hsa-miR-4481	CLIP-seq
MIRT2146068	hsa-miR-4663	CLIP-seq
MIRT2146069	hsa-miR-4708-5p	CLIP-seq
MIRT2146070	hsa-miR-4728-3p	CLIP-seq
MIRT2146071	hsa-miR-4745-5p	CLIP-seq
MIRT2146072	hsa-miR-4758-5p	CLIP-seq
MIRT2659988	hsa-miR-626	CLIP-seq
MIRT2659988	hsa-miR-626	CLIP-seq

Show/Hide all(6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002377	Process	Immunoglobulin production	IBA	21873635
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0006955	Process	Immune response	IBA	21873635
GO:0050900	Process	Leukocyte migration	TAS

MIM	HGNC	e!Ensembl
605141	12709	ENSG00000169575

Protein

UniProt ID

P12018

Protein name

Immunoglobulin iota chain (CD179 antigen-like family member A) (Protein VPreB1) (V(pre)B protein) (VpreB protein) (CD antigen CD179a)

Protein function

Associates with the Ig-mu chain to form a molecular complex that is expressed on the surface of pre-B-cells. This complex presumably regulates Ig gene rearrangements in the early steps of B-cell differentiation.

PDB

2H32 , 2H3N , 3BJ9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	24 → 132	Immunoglobulin V-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Only expressed by pre-B-cells.

Sequence

MSWAPVLLMLFVYCTGCGPQPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQR
PGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGAR
SSEKEEREREWEEEMEPTAARTRVP

Sequence length

145

Interactions

View interactions

	Reactome
			Cell surface interactions at the vascular wall

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Lymphoblastic leukemia	Childhood Acute Lymphoblastic Leukemia, L2 Acute Lymphoblastic Leukemia, Precursor Cell Lymphoblastic Leukemia Lymphoma	rs387906351, rs104894562, rs398122513, rs398122840, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699 View all (13 more)	26214592

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Alzheimer disease	Alzheimer disease			GWAS

Show/Hide Text Mining Associations (17)

Disease Name	Relationship Type	References
Associations from Text Mining
Arthritis Rheumatoid	Associate	33101545
Diabetes Mellitus	Associate	35260800
Diabetes Mellitus Type 1	Associate	35260800
Diabetes Mellitus Type 2	Associate	35260800
Drug Related Side Effects and Adverse Reactions	Associate	19138562, 33418558
Hematologic Neoplasms	Associate	1884024
Leukemia	Associate	1884018, 1884024
Leukemia Biphenotypic Acute	Associate	19138562
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	1884024
Leukemia Myeloid Acute	Associate	1884024
Lupus Erythematosus Systemic	Associate	12115231, 16126793
Lymphoma B Cell	Stimulate	14976526
Multiple Myeloma	Associate	33418558
Neoplasms	Associate	1884024, 19138562
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	27611867
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	1884024, 34662891, 39453390
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	19138562

VPREB1 (V-set pre-B cell surrogate light chain 1)