VIP (vasoactive intestinal peptide)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7432
Gene name Gene Name - the full gene name approved by the HGNC.
Vasoactive intestinal peptide
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
VIP
Synonyms (NCBI Gene) Gene synonyms aliases
PHM27
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q25.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. The
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(25)
miRTarBase ID miRNA Experiments Reference
MIRT016951 hsa-miR-335-5p Microarray 18185580
MIRT1484931 hsa-miR-181a CLIP-seq
MIRT1484932 hsa-miR-181b CLIP-seq
MIRT1484933 hsa-miR-181c CLIP-seq
MIRT1484934 hsa-miR-181d CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(3)
Transcription factor Regulation Reference
CREB1 Unknown 1847391
REST Unknown 15009665
STAT1 Unknown 12425940
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(29)
GO ID Ontology Definition Evidence Reference
GO:0001938 Process Positive regulation of endothelial cell proliferation IBA 21873635
GO:0005179 Function Hormone activity IDA 9603988
GO:0005184 Function Neuropeptide hormone activity IBA 21873635
GO:0005515 Function Protein binding IPI 21314817, 25416956
GO:0005576 Component Extracellular region TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
192320 12693 ENSG00000146469
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P01282
Protein name VIP peptides [Cleaved into: Intestinal peptide PHV-42 (Peptide histidine valine 42) (PHV-42); Intestinal peptide PHM-27 (Peptide histidine methioninamide 27) (PHM-27); Vasoactive intestinal peptide (VIP) (Vasoactive intestinal polypeptide)]
Protein function [Vasoactive intestinal peptide]: VIP is a neuropeptide involved in a diverse array of physiological processes through activating the PACAP subfamily of class B1 G protein-coupled receptors: VIP receptor 1 (VPR1) and VIP receptor 2 (VPR2) (PubMed
PDB 2RRH , 2RRI , 8E3Z
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00123 Hormone_2 81 → 108 Peptide hormone Family
PF00123 Hormone_2 125 → 152 Peptide hormone Family
Sequence 
MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDM
LQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPV
PVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK
Sequence length 170
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  cAMP signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling 		  G alpha (s) signalling events
Glucagon-type ligand receptors
ADORA2B mediated anti-inflammatory cytokines production
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (4)
Causal
Disease term Disease name dbSNP ID References
Autism Autistic Disorder rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699
View all (8 more)		 17521630
Mental retardation Profound Mental Retardation, Mental deficiency, Intellectual Disability rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)		 11357950
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 19189304
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 24674775
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Asperger Syndrome Asperger syndrome GenCC
Uterine Fibroids Uterine Fibroids GWAS
Show/Hide Text Mining Associations (108)
Associations from Text Mining
Disease Name Relationship Type References
Acidosis Stimulate 33815297
Adenocarcinoma Associate 8790198
Allergic Fungal Sinusitis Stimulate 32029445
Alzheimer Disease Associate 25390694
Amyloid Neuropathies Familial Associate 25973863
Amyotrophic Lateral Sclerosis Associate 26212797
Arthritis Inhibit 14680506
Arthritis Associate 29391448
Arthritis Rheumatoid Associate 10555038, 21337319, 25430993, 29391448
Arthritis Rheumatoid Inhibit 18383383