VIP (vasoactive intestinal peptide)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 7432
Gene name Vasoactive intestinal peptide
Gene symbol VIP
Synonyms (NCBI Gene)
PHM27
Chromosome 6
Chromosome location 6q25.2
Summary The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. The
miRNA miRNA information provided by mirtarbase database.
25
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (25)
miRTarBase ID miRNA Experiments Reference
MIRT016951 hsa-miR-335-5p Microarray 18185580
MIRT1484931 hsa-miR-181a CLIP-seq
MIRT1484932 hsa-miR-181b CLIP-seq
MIRT1484933 hsa-miR-181c CLIP-seq
MIRT1484934 hsa-miR-181d CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (3)
Transcription factor Regulation Reference
CREB1 Unknown 1847391
REST Unknown 15009665
STAT1 Unknown 12425940
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
37
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (37)
GO ID Ontology Definition Evidence Reference
GO:0001878 Process Response to yeast IDA 18603306
GO:0005179 Function Hormone activity IDA 9603988
GO:0005179 Function Hormone activity IEA
GO:0005184 Function Neuropeptide hormone activity IBA
GO:0005184 Function Neuropeptide hormone activity IDA 3456568, 36385145
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
192320 12693 ENSG00000146469
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P01282
Protein name VIP peptides [Cleaved into: Intestinal peptide PHV-42 (Peptide histidine valine 42) (PHV-42); Intestinal peptide PHM-27 (Peptide histidine methioninamide 27) (PHM-27); Vasoactive intestinal peptide (VIP) (Vasoactive intestinal polypeptide)]
Protein function [Vasoactive intestinal peptide]: VIP is a neuropeptide involved in a diverse array of physiological processes through activating the PACAP subfamily of class B1 G protein-coupled receptors: VIP receptor 1 (VPR1) and VIP receptor 2 (VPR2) (PubMed
PDB 2RRH , 2RRI , 8E3Z
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00123 Hormone_2 81 → 108 Peptide hormone Family
PF00123 Hormone_2 125 → 152 Peptide hormone Family
Sequence 
MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDM
LQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPV
PVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK
Sequence length 170
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  cAMP signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling 		  G alpha (s) signalling events
Glucagon-type ligand receptors
ADORA2B mediated anti-inflammatory cytokines production
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
See cases Uncertain significance rs2129074119 RCV001420639
Show/Hide Text Mining Associations (108)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acidosis Stimulate 33815297
Adenocarcinoma Associate 8790198
Allergic Fungal Sinusitis Stimulate 32029445
Alzheimer Disease Associate 25390694
Amyloid Neuropathies Familial Associate 25973863
Amyotrophic Lateral Sclerosis Associate 26212797
Arthritis Inhibit 14680506
Arthritis Associate 29391448
Arthritis Rheumatoid Associate 10555038, 21337319, 25430993, 29391448
Arthritis Rheumatoid Inhibit 18383383