Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7425
Gene name Gene Name - the full gene name approved by the HGNC.
VGF nerve growth factor inducible
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
VGF
Synonyms (NCBI Gene) Gene synonyms aliases
SCG7, SgVII
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is specifically expressed in a subpopulation of neuroendocrine cells, and is upregulated by nerve growth factor. The structural organization of this gene is similar to that of the rat gene, and both the translated and the untranslated regions sh
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT491307 hsa-miR-3195 PAR-CLIP 20371350
MIRT491300 hsa-miR-1237-5p PAR-CLIP 20371350
MIRT491299 hsa-miR-4488 PAR-CLIP 20371350
MIRT491298 hsa-miR-4697-5p PAR-CLIP 20371350
MIRT491297 hsa-miR-328-5p PAR-CLIP 20371350
Transcription factors
Transcription factor Regulation Reference
NPAS3 Unknown 21709683
REST Unknown 19118055
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001541 Process Ovarian follicle development IEA
GO:0002021 Process Response to dietary excess IEA
GO:0003674 Function Molecular_function ND
GO:0005179 Function Hormone activity IBA 21873635
GO:0005184 Function Neuropeptide hormone activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602186 12684 ENSG00000128564
Protein
UniProt ID O15240
Protein name Neurosecretory protein VGF [Cleaved into: Neuroendocrine regulatory peptide-1 (NERP-1); Neuroendocrine regulatory peptide-2 (NERP-2); VGF-derived peptide TLQP-21; VGF-derived peptide TLQP-62; Antimicrobial peptide VGF[554-577]]
Protein function [Neurosecretory protein VGF]: Secreted polyprotein that is packaged and proteolytically processed by prohormone convertases PCSK1 and PCSK2 in a cell-type-specific manner (By similarity). VGF and peptides derived from its processing play many ro
PDB 7D13 , 7D16 , 8H0G , 8H0U
Family and domains
Tissue specificity TISSUE SPECIFICITY: Central and peripheral nervous systems, synthesized exclusively in neuronal and neuroendocrine cells. {ECO:0000269|PubMed:19194657}.
Sequence
MKALRLSASALFCLLLINGLGAAPPGRPEAQPPPLSSEHKEPVAGDAVPGPKDGSAPEVR
GARNSEPQDEGELFQGVDPRALAAVLLQALDRPASPPAPSGSQQGPEEEAAEALLTETVR
SQTHSLPAPESPEPAAPPRPQTPENGPEASDPSEELEALASLLQELRDFSPSSAKRQQET
AAAETETRTHTLTRVNLESPGPERVWRASWGEFQARVPERAPLPPPAPSQFQARMPDSGP
LPETHKFGEGVSSPKTHLGEALAPLSKAYQGVAAPFPKARRPESALLGGSEAGERLLQQG
LAQVEAGRRQAEATRQAAAQEERLADLASDLLLQYLLQGGARQRGLGGRGLQEAAEERES
AREEEEAEQERRGGEERVGEEDEEAAEAEAEAEEAERARQNALLFAEEEDGEAGAEDKRS
QEETPGHRRKEAEGTEEGGEEEDDEEMDPQTIDSLIELSTKLHLPADDVVSIIEEVEEKR
KRKKNAPPEPVPPPRAAPAPTHVRSPQPPPPAPAPARDELPDWNEVLPPWDREEDEVYPP
GPYHPFPNYIRPRTLQPPSALRRRHYHHALPPSRHYPGREAQARRAQEEAEAEERRLQEQ
EELENYIEHVLLRRP
Sequence length 615
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Neuroactive ligand-receptor interaction   Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation
NGF-stimulated transcription
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Mental depression Mental Depression, Depressive disorder 18983874, 20631166, 18815270, 22990943 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 37742030
Alzheimer Disease Associate 22046305, 26270474, 30578620, 32301581, 36776048
Alzheimer Disease Stimulate 26142708
Alzheimer Disease Inhibit 32366888, 36912488
Amyotrophic Lateral Sclerosis Inhibit 32174778
Anhedonia Associate 24934694
Autistic Disorder Associate 33893496
Bipolar Disorder Associate 24934694
Brain Diseases Associate 21838886
Breast Neoplasms Associate 19228724, 24277232, 24927296