VEGFC (vascular endothelial growth factor C)

Gene

• Entrez ID: 7424
• Gene name: Vascular endothelial growth factor C
• Gene symbol: VEGFC
• Synonyms (NCBI Gene): Flt4-L, LMPH1D, LMPHM4, VRP
• Disease Acronyms (UniProt): LMPHM4
• Chromosome: 4
• Chromosome location: 4q34.3
• Summary: The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family. The encoded protein promotes angiogenesis and endothelial cell growth, and can also affect the permeability of blood

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs587777566	->AA	Pathogenic	Frameshift variant, coding sequence variant
rs587777567	G>A	Pathogenic	Stop gained, coding sequence variant
rs1057524647	T>A	Pathogenic	Splice acceptor variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021989	hsa-miR-128-3p	Microarray	17612493
MIRT054253	hsa-miR-27b-3p	ELISA, Immunofluorescence, Microarray, Luciferase reporter assay, QRTPCR, Western blot	23593282
MIRT021989	hsa-miR-128-3p	SK-MES-1	25001183
MIRT021989	hsa-miR-128-3p	SK-MES-1	25001183
MIRT631912	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT531421	hsa-miR-3200-5p	HITS-CLIP	23824327
MIRT631911	hsa-miR-6501-3p	HITS-CLIP	23824327
MIRT675482	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT631910	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT631909	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT631908	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT675481	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT631907	hsa-miR-1285-3p	HITS-CLIP	23824327
MIRT631906	hsa-miR-3187-5p	HITS-CLIP	23824327
MIRT631905	hsa-miR-5189-5p	HITS-CLIP	23824327
MIRT631904	hsa-miR-612	HITS-CLIP	23824327
MIRT631902	hsa-miR-6860	HITS-CLIP	23824327
MIRT675480	hsa-miR-4252	HITS-CLIP	23824327
MIRT631903	hsa-miR-661	HITS-CLIP	23824327
MIRT631901	hsa-miR-196a-3p	HITS-CLIP	23824327
MIRT631900	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT631899	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT675479	hsa-miR-7703	HITS-CLIP	23824327
MIRT631912	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT531421	hsa-miR-3200-5p	HITS-CLIP	23824327
MIRT631911	hsa-miR-6501-3p	HITS-CLIP	23824327
MIRT631910	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT631909	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT631908	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT631907	hsa-miR-1285-3p	HITS-CLIP	23824327
MIRT631906	hsa-miR-3187-5p	HITS-CLIP	23824327
MIRT631905	hsa-miR-5189-5p	HITS-CLIP	23824327
MIRT631904	hsa-miR-612	HITS-CLIP	23824327
MIRT631902	hsa-miR-6860	HITS-CLIP	23824327
MIRT631903	hsa-miR-661	HITS-CLIP	23824327
MIRT631901	hsa-miR-196a-3p	HITS-CLIP	23824327
MIRT631900	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT631899	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT531424	hsa-miR-548m	PAR-CLIP	22012620
MIRT531423	hsa-miR-577	PAR-CLIP	22012620
MIRT531422	hsa-miR-4678	PAR-CLIP	22012620
MIRT531421	hsa-miR-3200-5p	PAR-CLIP	22012620
MIRT531420	hsa-miR-3185	PAR-CLIP	22012620
MIRT531419	hsa-miR-4668-5p	PAR-CLIP	22012620
MIRT439305	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439305	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT732064	hsa-miR-101-3p	ELISA, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26460960
MIRT732064	hsa-miR-101-3p	ELISA, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26460960
MIRT054253	hsa-miR-27b-3p	ELISA, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26460960
MIRT054253	hsa-miR-27b-3p	ELISA, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26460960
MIRT021989	hsa-miR-128-3p	ELISA, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26460960
MIRT021989	hsa-miR-128-3p	ELISA, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26460960
MIRT732064	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	26299768
MIRT732064	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	26299768
MIRT054253	hsa-miR-27b-3p	RNA-seq	31722236
MIRT733612	hsa-miR-335-5p	Luciferase reporter assay, qRT-PCR, Western blotting	33968662
MIRT631912	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT531421	hsa-miR-3200-5p	HITS-CLIP	23824327
MIRT631911	hsa-miR-6501-3p	HITS-CLIP	23824327
MIRT675482	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT631910	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT631909	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT631908	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT675481	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT631907	hsa-miR-1285-3p	HITS-CLIP	23824327
MIRT631906	hsa-miR-3187-5p	HITS-CLIP	23824327
MIRT631905	hsa-miR-5189-5p	HITS-CLIP	23824327
MIRT631904	hsa-miR-612	HITS-CLIP	23824327
MIRT631902	hsa-miR-6860	HITS-CLIP	23824327
MIRT675480	hsa-miR-4252	HITS-CLIP	23824327
MIRT631903	hsa-miR-661	HITS-CLIP	23824327
MIRT631901	hsa-miR-196a-3p	HITS-CLIP	23824327
MIRT631900	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT631899	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT675479	hsa-miR-7703	HITS-CLIP	23824327
MIRT631912	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT531421	hsa-miR-3200-5p	HITS-CLIP	23824327
MIRT631911	hsa-miR-6501-3p	HITS-CLIP	23824327
MIRT631910	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT631909	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT631908	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT631907	hsa-miR-1285-3p	HITS-CLIP	23824327
MIRT631906	hsa-miR-3187-5p	HITS-CLIP	23824327
MIRT631905	hsa-miR-5189-5p	HITS-CLIP	23824327
MIRT631904	hsa-miR-612	HITS-CLIP	23824327
MIRT631902	hsa-miR-6860	HITS-CLIP	23824327
MIRT631903	hsa-miR-661	HITS-CLIP	23824327
MIRT631901	hsa-miR-196a-3p	HITS-CLIP	23824327
MIRT631900	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT631899	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT531424	hsa-miR-548m	PAR-CLIP	22012620
MIRT531423	hsa-miR-577	PAR-CLIP	22012620
MIRT531422	hsa-miR-4678	PAR-CLIP	22012620
MIRT531421	hsa-miR-3200-5p	PAR-CLIP	22012620
MIRT531420	hsa-miR-3185	PAR-CLIP	22012620
MIRT531419	hsa-miR-4668-5p	PAR-CLIP	22012620
MIRT755836	hsa-miR-513a-5p	Luciferase reporter assay, Western blotting, qRT-PCR, in vitro cullelar assays, In situ hybridization, Flow cytometry, in vivo gain/loss-of-function experiments	36617735
MIRT1483898	hsa-miR-369-3p	CLIP-seq
MIRT1483899	hsa-miR-374c	CLIP-seq
MIRT1483900	hsa-miR-4666-3p	CLIP-seq
MIRT1483901	hsa-miR-579	CLIP-seq
MIRT1483902	hsa-miR-655	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
RUNX2	Activation	22641097
SIX1	Activation	22466647

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IBA	21873635
GO:0001934	Process	Positive regulation of protein phosphorylation	IBA	21873635
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IBA	21873635
GO:0002040	Process	Sprouting angiogenesis	IBA	21873635
GO:0002052	Process	Positive regulation of neuroblast proliferation	IEA
GO:0002576	Process	Platelet degranulation	TAS
GO:0005172	Function	Vascular endothelial growth factor receptor binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	20145116, 21130043, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006929	Process	Substrate-dependent cell migration	TAS	8617204
GO:0007165	Process	Signal transduction	TAS	8617204
GO:0008083	Function	Growth factor activity	IBA	21873635
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	8617204
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0016020	Component	Membrane	IEA
GO:0016331	Process	Morphogenesis of embryonic epithelium	IEA
GO:0030947	Process	Regulation of vascular endothelial growth factor receptor signaling pathway	IEA
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0031954	Process	Positive regulation of protein autophosphorylation	IEA
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IBA	21873635
GO:0042056	Function	Chemoattractant activity	IBA	21873635
GO:0042056	Function	Chemoattractant activity	IDA	19275959
GO:0042493	Process	Response to drug	IEA
GO:0043185	Function	Vascular endothelial growth factor receptor 3 binding	IBA	21873635
GO:0043185	Function	Vascular endothelial growth factor receptor 3 binding	IPI	23878260
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IEA
GO:0045668	Process	Negative regulation of osteoblast differentiation	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IBA	21873635
GO:0045776	Process	Negative regulation of blood pressure	IEA
GO:0045860	Process	Positive regulation of protein kinase activity	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IBA	21873635
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IDA	23878260
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0050714	Process	Positive regulation of protein secretion	IEA
GO:0050918	Process	Positive chemotaxis	IEA
GO:0050930	Process	Induction of positive chemotaxis	IBA	21873635
GO:0050930	Process	Induction of positive chemotaxis	IDA	19275959
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0060754	Process	Positive regulation of mast cell chemotaxis	IBA	21873635
GO:0060754	Process	Positive regulation of mast cell chemotaxis	IDA	19275959
GO:1901492	Process	Positive regulation of lymphangiogenesis	IEA
GO:1902462	Process	Positive regulation of mesenchymal stem cell proliferation	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA

Other IDs

• MIM: 601528
• HGNC: 12682
• e!Ensembl: ENSG00000150630

Protein

• UniProt ID: P49767
• Protein name: Vascular endothelial growth factor C (VEGF-C) (Flt4 ligand) (Flt4-L) (Vascular endothelial growth factor-related protein) (VRP)
• Protein function: Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems
• PDB: 2X1W, 2X1X, 4BSK, 6TJT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00341	PDGF	131 → 211	PDGF/VEGF domain	Domain
  PF03128	CXCXC	283 → 295	CXCXC repeat	Repeat
  PF03128	CXCXC	308 → 319	CXCXC repeat	Repeat
  PF03128	CXCXC	331 → 343	CXCXC repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the spleen (PubMed:8700872, PubMed:9247316). Expressed in the lymph node, thymus, appendix and bone marrow (PubMed:9247316). Expressed in the heart, placenta, skeletal muscle, ovary and small intestine (PubMed:8617204, Pub
• Sequence:

  MHLLGFFSVACSLLAAALLPGPREAPAAAAAFESGLDLSDAEPDAGEATAYASKDLEEQL
  RSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILK
  SIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSY
  LSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAAN
  KTCPTNYMWNNHICRCLAQEDFMFSSDAGDDSTDGFHDICGPNKELDEETCQCVCRAGLR
  PASCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENTCQCVCKRTCPRNQPLNPGKCAC
  ECTESPQKCLLKGKKFHHQTCSCYRRPCTNRQKACEPGFSYSEEVCRCVPSYWKRPQMS

• Sequence length: 419

Pathways

KEGG:

MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
TNF signaling pathway
Relaxin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Pathways in cancer

Reactome:

Platelet degranulation
VEGF ligand-receptor interactions
VEGF binds to VEGFR leading to receptor dimerization

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158, rs80357524, rs80357115, rs80357945, rs80357729, rs80357609, rs80357259, rs80357981, rs80358063, rs80357389, rs80356862, rs80359876, rs80357580, rs80358053, rs80358089, rs80187739, rs397507241, rs80358069, rs80357590, rs80357284, rs80357941, rs80359261, rs80359272, rs80359276, rs276174813, rs80358474, rs80359316, rs1555282969, rs80359388, rs80359499, rs80359505, rs80359520, rs80359526, rs80359533, rs56253082, rs80358824, rs80359554, rs80359636, rs80359651, rs80359659, rs80359011, rs80359012, rs80359013, rs80359718, rs397507410, rs81002812, rs80359730, rs80359152, rs80359159, rs397507419, rs28897759, rs80359211, rs80359775, rs397514577, rs397507584, rs80358435, rs80358456, rs80359340, rs80359343, rs80359365, rs80358579, rs397507670, rs80358593, rs80359406, rs80359444, rs80359454, rs276174853, rs276174854, rs80359483, rs80359537, rs80358815, rs80358843, rs80359558, rs80359560, rs80359594, rs80358893, rs28897743, rs397507900, rs397507906, rs397507918, rs80358971, rs80358981, rs397507941, rs80359030, rs80359035, rs41293511, rs397507396, rs81002806, rs80359112, rs397508006, rs81002893, rs45580035, rs80359760, rs397508051, rs80359772, rs4987049, rs80359777, rs80357770, rs397508867, rs62625303, rs397508874, rs80357506, rs80357287, rs273898674, rs80358042, rs80358083, rs80357058, rs41286296, rs80357960, rs80356945, rs80357223, rs386134270, rs80358116, rs80357856, rs80357424, rs397509050, rs80357485, rs80357966, rs397509067, rs80357310, rs80356866, rs80357260, rs80357437, rs80358023, rs80358086, rs80357133, rs80356993, rs80357997, rs80357239, rs80357227, rs397509243, rs80356969, rs80356959, rs63750617, rs63751319, rs587779315, rs200640585, rs398122546, rs80357543, rs398122687, rs80359328, rs398122779, rs398122783, rs62517194, rs80358029, rs515726060, rs180177103, rs180177111, rs180177133, rs587776527, rs180177135, rs180177136, rs515726117, rs587779813, rs587779909, rs587780024, rs587780100, rs28909982, rs121908698, rs180177100, rs587780210, rs587780240, rs587780639, rs587781269, rs587781353, rs587781471, rs587781658, rs587781697, rs587781730, rs587781894, rs587781948, rs587782005, rs587782011, rs200928781, rs587781558, rs370228071, rs587782245, rs587782401, rs180177110, rs587782504, rs72552322, rs587782531, rs587782620, rs587782680, rs587782774, rs587782818, rs730881411, rs730881389, rs564652222, rs397507768, rs587776419, rs730881868, rs730881940, rs56383036, rs758972589, rs201089102, rs730881348, rs786202608, rs786201886, rs786203318, rs786203775, rs786203714, rs786202033, rs750621215, rs786203884, rs786203650, rs772821016, rs863224521, rs864622223, rs864622655, rs375699023, rs876659572, rs768362387, rs876659535, rs876658957, rs483353072, rs876659435, rs267608041, rs876661113, rs730881369, rs878853535, rs772228129, rs878855122, rs760551339, rs80359596, rs397509222, rs886039630, rs886039683, rs886040828, rs587781799, rs886040374, rs886040649, rs397507967, rs878854957, rs886040043, rs1057517589, rs1060502769, rs866380588, rs863224765, rs1064793243, rs747563556, rs1555074976, rs1064795885, rs753961188, rs1064794708, rs869312772, rs1064793887, rs1131690820, rs1135401928, rs1135401868, rs1135401859, rs1553370324, rs397507630, rs1555283160, rs1555283251, rs1555283262, rs1555283361, rs1555286298, rs1555288462, rs886040950, rs1555289566, rs776323117, rs80357123, rs1555579627, rs1555580697, rs80358054, rs1555593302, rs1328985852, rs763470424, rs1555139694, rs878854697, rs1555461217, rs1555461765, rs774684620, rs766416564, rs1554558613, rs1305740166, rs1555461460, rs1555461407, rs1555461586, rs1555567202, rs1555607022, rs1555069815, rs1442299125, rs1474786480, rs1555084947, rs1555457867, rs141087784, rs1482641121, rs1564830522, rs1565469955, rs1565503137, rs864622613, rs755263466, rs757679199, rs1593903166, rs1597801649, rs1603293306, rs879253880, rs80358754, rs1597062038, rs45494092, rs1603275367, rs887358871, rs1597091518, rs1966967065, rs1064793049, rs2082872908, rs2085078278, rs2072475243	26124351, 18509974
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451, rs397507859, rs80359709, rs80359742, rs80359205, rs80357627, rs80357004, rs80357571, rs80357767, rs80357653, rs80358086, rs80357608, rs28897696, rs41293465, rs146650273, rs63751017, rs63750617, rs63750726, rs63750199, rs63749848, rs398122618, rs398122653, rs397509211, rs80357791, rs121912666, rs587778541, rs121908698, rs536907995, rs587781302, rs140342925, rs587781506, rs587782652, rs587782849, rs587783057, rs139770721, rs374950566, rs786202800, rs863224451, rs377153250, rs747727055, rs876658804, rs780001540, rs760815829, rs878854926, rs775248597, rs886040658, rs886040192, rs786203523, rs886040319, rs397508006, rs587782011, rs1060502772, rs1555461727, rs1553333072, rs1114167702, rs1257401983, rs886040950, rs1060502759, rs774684620, rs142947311, rs1555580883, rs748513310, rs376170600, rs863224499, rs1593909229, rs748453607, rs1294578913, rs1574737047, rs1593909960, rs2081922847, rs2082559544, rs2053694038	18509974, 26124351
Lymphatic malformation	LYMPHATIC MALFORMATION 4	rs267606847, rs267606846, rs587777566, rs587777567, rs786205669, rs869025596, rs869025597, rs869025598, rs869025599, rs869025600, rs869025601, rs1057519263, rs1057519264, rs587776992, rs934897228, rs1569227576, rs1569133268, rs1569226110, rs1569141899, rs1569124017, rs1562967463, rs1567659736, rs1166021430, rs1584651110, rs1574226259	30071673
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465, rs137854466, rs137854467, rs387906547, rs387906548, rs137854469, rs137854473, rs1131692050, rs112989722, rs137854474, rs137854476, rs140593, rs1555395819, rs137854478, rs137854479, rs137854480, rs137854481, rs137854482, rs137854483, rs137854484, rs137854485, rs112289537, rs193922181, rs193922182, rs193922185, rs140603, rs193922187, rs193922188, rs193921256, rs112660651, rs193922193, rs193922194, rs193922197, rs193922198, rs193922199, rs193922203, rs193922204, rs193922205, rs193922206, rs111401431, rs193922207, rs113871094, rs111671429, rs193922216, rs193922219, rs193922220, rs193922223, rs193922224, rs193922225, rs193922226, rs193922227, rs193922228, rs193922230, rs193922235, rs147195031, rs193922236, rs193922239, rs193922240, rs193922241, rs193922246, rs397514558, rs398122934, rs397515753, rs397515754, rs397515755, rs397515756, rs397515757, rs113812345, rs397515758, rs397515759, rs397515762, rs25403, rs397515765, rs397515766, rs397515767, rs397515768, rs397515769, rs397515770, rs397515771, rs25404, rs397515773, rs397515774, rs397515775, rs397515776, rs397515778, rs397515779, rs397515781, rs112202622, rs397515782, rs397515784, rs397515785, rs397515786, rs397515788, rs397515789, rs397515790, rs397515791, rs397515792, rs397515793, rs397515794, rs397515797, rs397515798, rs397515799, rs397515801, rs397515802, rs397515803, rs397515804, rs397515805, rs397515808, rs397515810, rs397515811, rs397515812, rs111231312, rs267606798, rs397515814, rs113905529, rs397515816, rs397515817, rs397515818, rs397515819, rs397515820, rs363853, rs113249837, rs397515821, rs111929350, rs397515823, rs397515824, rs113086760, rs397515825, rs397515826, rs397515827, rs363807, rs397515828, rs397515829, rs397515830, rs397515831, rs397515833, rs111687884, rs113080385, rs397515834, rs397515836, rs113001196, rs397515840, rs397515845, rs397515846, rs397515847, rs397515848, rs397515851, rs397515852, rs397515853, rs397515854, rs111856492, rs397515859, rs397515861, rs397515863, rs397515864, rs397515865, rs397515866, rs397515867, rs137854855, rs199474693, rs587782944, rs587782947, rs587782948, rs672601352, rs876658120, rs727504651, rs727503054, rs727504315, rs727504411, rs727503057, rs727504454, rs200309328, rs363811, rs727504410, rs363821, rs727504347, rs727505006, rs727505110, rs730880356, rs727505269, rs727503058, rs727504421, rs730880107, rs730880104, rs730880103, rs730880102, rs730880101, rs730880106, rs730880100, rs730880105, rs730880099, rs112645512, rs730880108, rs730880098, rs730880097, rs794728321, rs794728283, rs794728280, rs794728336, rs794728272, rs794728160, rs794728271, rs794728270, rs794728319, rs794728262, rs794728251, rs76702162, rs794728335, rs794728334, rs794728246, rs763091520, rs794728333, rs794728237, rs761857514, rs794728234, rs140630, rs794728231, rs794728228, rs794728225, rs794728308, rs794728216, rs794728221, rs763449629, rs201058219, rs794728210, rs794728208, rs794728206, rs794728199, rs794728195, rs794728194, rs794728193, rs794728190, rs1555399381, rs794728176, rs1555399968, rs113422242, rs794728326, rs794728166, rs794728325, rs794728165, rs794728162, rs794728213, rs869025417, rs112642323, rs869025416, rs869025415, rs869025424, rs869025423, rs869025414, rs869025422, rs869025413, rs869025412, rs869025411, rs869025418, rs869025426, rs869025406, rs869025421, rs869025425, rs869025404, rs869025420, rs869025403, rs398122833, rs876657645, rs878853686, rs878853676, rs886038919, rs886038795, rs187553035, rs886038869, rs886038949, rs886038967, rs886038976, rs886038848, rs886038940, rs886038877, rs886039038, rs886038817, rs886038963, rs886039036, rs886038797, rs886039550, rs886041482, rs1057517855, rs1057518912, rs1057518973, rs1057519502, rs1057521100, rs1057521102, rs1057518881, rs1057520617, rs1057521101, rs1555394445, rs369058466, rs1060501069, rs1060501031, rs778966916, rs1060501043, rs1555397663, rs1060501017, rs1060501094, rs1060501065, rs1555393848, rs1555394151, rs1060501051, rs1060501013, rs1060501054, rs1060501048, rs1060501089, rs1060501039, rs1555398160, rs1060501022, rs1060501024, rs1060501086, rs1060501058, rs1060501036, rs1060501100, rs1060501042, rs1060501059, rs1555397743, rs1060501021, rs1060501027, rs1060501096, rs1060501038, rs1060501050, rs1064794130, rs112118237, rs1064793980, rs1064793118, rs1064793636, rs1064794282, rs1064793559, rs1085307921, rs1085308004, rs1085307468, rs112907302, rs1131691479, rs1131691373, rs1131691467, rs1131691938, rs1131691311, rs1131691806, rs1131691317, rs1555393827, rs363804, rs1555397738, rs1555399144, rs1555400274, rs1555394195, rs1555398836, rs113543334, rs1555399825, rs1555394626, rs1555395256, rs1555395257, rs1555396427, rs1555397548, rs1555398173, rs1555404803, rs1232880706, rs1555393825, rs1555394567, rs1555396998, rs1555394928, rs1555397203, rs112375043, rs1555397720, rs140599, rs1555399150, rs1555400373, rs1555405041, rs1555395229, rs1555397671, rs775417975, rs1555398774, rs1555399368, rs1555394904, rs1555395987, rs1555397424, rs1555398377, rs1555398835, rs1555401011, rs1555405043, rs1555394580, rs1555397404, rs1555398511, rs1555395826, rs1555399372, rs1555399821, rs1555399836, rs1555400063, rs363810, rs1555397655, rs1555395756, rs1555395742, rs1555393844, rs112550005, rs1555395002, rs1555395658, rs765387131, rs1555396429, rs1555396835, rs1555397014, rs1555397016, rs778710767, rs1555397557, rs1555397704, rs140648, rs1555398406, rs1555398681, rs1555399257, rs1555399361, rs1555399764, rs1555405056, rs1555393510, rs1555395980, rs1555396789, rs1555399094, rs1555399378, rs1555399816, rs1555395645, rs371097218, rs1555398278, rs1555394238, rs1555396418, rs1206813753, rs1555399271, rs1555405044, rs113544411, rs1555395663, rs1555397216, rs1555398989, rs1555399149, rs1555401670, rs1555395001, rs1445085747, rs1555393538, rs1555393565, rs1404133653, rs1555394450, rs1555394581, rs1555394633, rs1555394900, rs1555395189, rs1555395261, rs1052480459, rs1555395480, rs1555395670, rs363806, rs1555395820, rs1555396419, rs1555396765, rs1296209846, rs794728233, rs1555396853, rs1555396863, rs1555397197, rs1555397204, rs1555397212, rs1555397713, rs1555397736, rs1555398139, rs1555398144, rs1555398409, rs1555398510, rs1555398520, rs1555398524, rs1555398667, rs1555399089, rs1555399482, rs1555399763, rs1555401002, rs794728323, rs1555393508, rs1555393514, rs1555393525, rs1555393532, rs1555393653, rs1555393657, rs1555393824, rs1555393831, rs112196241, rs1555393847, rs1555393862, rs1555393863, rs1555393866, rs113935744, rs1555393882, rs1555393886, rs1555393889, rs1555394138, rs1555394144, rs1555394146, rs1555394148, rs1555394149, rs1555394152, rs1555394153, rs1555394189, rs1555394197, rs1555394206, rs1555394212, rs1555394218, rs1555394220, rs1555394235, rs1555394245, rs1555394246, rs1057520728, rs1555394390, rs1555394391, rs537570299, rs1555394397, rs1555394398, rs1555394399, rs1555394402, rs1555394407, rs1555394412, rs1555394435, rs1555394436, rs1555394441, rs1555394556, rs1555394557, rs1555394559, rs1555394561, rs1555394570, rs397515844, rs1555394571, rs1555394574, rs1555394579, rs1555394582, rs534811966, rs111588631, rs1555394628, rs1555394629, rs1555394630, rs1555394631, rs1555394641, rs1555394644, rs1555394647, rs1555394756, rs886051245, rs1555394775, rs1555394776, rs1555394777, rs1555394779, rs1555394780, rs1555394783, rs1555394901, rs1555394906, rs1555394925, rs794728253, rs886039158, rs1555395013, rs1555395187, rs1555395188, rs1555395203, rs1555395205, rs363815, rs1246984265, rs794728245, rs1555395263, rs1555395267, rs1555395456, rs1555395475, rs1555395482, rs1555395638, rs1555395641, rs1555395648, rs1555395653, rs1555395659, rs111239111, rs1555395745, rs1555395747, rs1555395753, rs1555395757, rs1555395766, rs1555395767, rs1555395843, rs1555395846, rs1555395849, rs1555395978, rs1555395981, rs1555395984, rs1555395989, rs1555395990, rs1260109901, rs1555396186, rs1555396188, rs1555396198, rs1555396199, rs1555396201, rs1555396202, rs1555396205, rs1555396213, rs1555396424, rs1555396426, rs1555396428, rs1555396435, rs1555396630, rs1555396635, rs1555396636, rs1555396639, rs1555396757, rs1555396769, rs1555396838, rs1555396844, rs140627, rs1555396858, rs1555396990, rs1555396991, rs1555396993, rs769588424, rs1555397022, rs1555397024, rs1555397160, rs1555397174, rs1555397176, rs1555397193, rs1555397209, rs1555397210, rs1555397214, rs1060501076, rs113082854, rs113693945, rs111978932, rs1555397403, rs1555397419, rs1555397420, rs1555397421, rs1555397536, rs1555397537, rs1555397540, rs1555397542, rs1555397543, rs1555397545, rs1555397546, rs1555397670, rs1555397692, rs1555397718, rs1555397723, rs1555397744, rs113393517, rs1555398148, rs1555398152, rs1555398174, rs1555398176, rs1555398179, rs1555398282, rs1555398287, rs1555398380, rs1555398394, rs1555398397, rs1555398401, rs1555398404, rs1555398407, rs1555398413, rs1555398501, rs1555398508, rs1555398512, rs1555398513, rs1555398515, rs1555398521, rs794728205, rs1555398527, rs1555398551, rs1060501075, rs1555398566, rs1555398572, rs1555398580, rs1555398582, rs140597, rs1555398622, rs1555398624, rs1555398625, rs112547596, rs1555398627, rs1555398633, rs1555398637, rs1555398642, rs778867355, rs1555398648, rs1555398659, rs1293095681, rs1060501040, rs987202268, rs1555398672, rs1555398673, rs1555398677, rs1555398793, rs1555398803, rs1555398811, rs1555398826, rs1555398833, rs1555398974, rs1555398981, rs778900586, rs1555398988, rs1555398994, rs1555398995, rs1555398996, rs1555399093, rs869025405, rs1555399101, rs1555399146, rs1555399160, rs1555399162, rs1555399164, rs1555399165, rs1555399193, rs1555399195, rs1555399202, rs1555399204, rs1555399206, rs201778577, rs1555399210, rs1555399214, rs1555399270, rs1555399273, rs1555399281, rs1555399371, rs1555399385, rs1555399477, rs1555399484, rs1555399761, rs1555399775, rs1555399802, rs1555399804, rs1555399837, rs1555399840, rs1555399940, rs1555399944, rs1555399949, rs1555399953, rs1555399954, rs1555399955, rs1555399959, rs1555399962, rs1555399963, rs1060501041, rs1555399974, rs1555399976, rs1555399977, rs1555400049, rs794728172, rs1555400062, rs1555400064, rs1555400066, rs1555400267, rs1555400268, rs1555400278, rs794728168, rs1555400279, rs1156747241, rs1555400288, rs1555400371, rs1555400372, rs1555400379, rs1555400385, rs587782943, rs1555400387, rs1555400406, rs1439533354, rs746201757, rs1555400595, rs1555400603, rs1555400604, rs1555400606, rs1555400609, rs752010116, rs1555400612, rs1555400616, rs1555401004, rs1555401005, rs146348130, rs1555401667, rs1555401671, rs1555401676, rs1555401679, rs1555401687, rs1555401689, rs1555401695, rs1555401697, rs1555401701, rs1555404799, rs1555404800, rs200295020, rs1555404810, rs1555404820, rs1555405031, rs1555405039, rs1555405045, rs1555405530, rs794728292, rs1555405533, rs1555405536, rs1555405537, rs111764111, rs1555405658, rs1555405664, rs774371494, rs1555405673, rs1555407399, rs1555407414, rs1555407423, rs1555407429, rs886041536, rs1555404806, rs1566911709, rs1566913974, rs1566894226, rs1566895223, rs1566897376, rs1566902526, rs1566915277, rs1566897374, rs1566897420, rs1566891655, rs1346043320, rs1566922396, rs1566891706, rs1566894783, rs1566913670, rs1555394196, rs1566891454, rs1566891406, rs1566891404, rs1566895262, rs1566891645, rs1566895225, rs1566896114, rs1566898399, rs1566904011, rs1566906537, rs1566908956, rs1566909766, rs1566919599, rs1566937712, rs1566915335, rs1566891675, rs1566904526, rs1566906506, rs1566900540, rs1566894230, rs1555395206, rs1566891797, rs1597512576, rs1597523873, rs1597581001, rs1597516325, rs1057524757, rs1597506641, rs1597520781, rs1597593695, rs1597529829, rs1597520625, rs1597579923, rs1597531796, rs1008275504, rs1597567249, rs1597569265, rs1597652471, rs1597516347, rs1597577114, rs1597633163, rs1597519658, rs1597593852, rs1597516501, rs1566913982, rs1555393859, rs1597513708, rs368978109, rs1480832655, rs1597520683, rs1597522390, rs1597522553, rs1597529748, rs1597533707, rs1597537815, rs1597545309, rs1597545836, rs1597563234, rs1597563280, rs1597564359, rs772108557, rs1597568968, rs1597574236, rs1597574308, rs1597577975, rs193922179, rs1597581005, rs1597593736, rs1597623670, rs1597625734, rs1597631662, rs113604459, rs1597633183, rs1597633219, rs1597518951, rs1555394781, rs1597525871, rs1597526073, rs1597569159, rs1597569536, rs1597563934, rs1597545199, rs1364210063, rs1597552583, rs1597520619, rs1597540854, rs1597591602, rs1597569551, rs1597548716, rs1597553721, rs112728248, rs1597537858, rs1597517935, rs1597540907, rs1597552388, rs1597591643, rs1597529841, rs1597506547, rs1597509836, rs1597529686, rs1566897404, rs1597533713, rs1597543486, rs1597545257, rs1597545345, rs1597548672, rs1597562812, rs1597563287, rs1597571391, rs1555400052, rs1597583989, rs363852, rs1597547226, rs363808, rs974604498, rs2043595650, rs2043526284, rs2042997306, rs1555397195, rs886039054, rs1555397213, rs2042873946	26124351, 18509974
Melanoma	melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340, rs398123152, rs587780668, rs587782083, rs587782206, rs587782792, rs180177042, rs121913381, rs730881675, rs730881674, rs730881677, rs730881673, rs1800586, rs768966657, rs587778189, rs786204195, rs121913321, rs45476696, rs864622636, rs864622263, rs869025340, rs876660436, rs876658534, rs876658556, rs878853647, rs878853644, rs878853650, rs886041162, rs121913389, rs1057519852, rs121913384, rs121913387, rs1060501266, rs1060501263, rs1060501262, rs749714198, rs1060501265, rs559848002, rs1064794292, rs1131691187, rs1131691186, rs199907548, rs1554654052, rs1554656411, rs1554656624, rs1554653915, rs1554653956, rs1554656253, rs1554654224, rs754806883, rs1057520039, rs1563889584, rs1563889685, rs1287464120, rs1563888944, rs1563892715, rs1563889847, rs141798398, rs1587332338, rs1587340291, rs11552823, rs561034503, rs138677674, rs1819962958, rs1820531050	17562445

Unknown
Disease term	Disease name	Evidence	References	Source
Hemangiosarcoma	Hemangiosarcoma		17569031	ClinVar
Specific learning disorder	Specific learning disability			ClinVar
Lymphatic Malformation	lymphatic malformation			GenCC
Alzheimer disease	Alzheimer disease			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Adenocarcinoma	Associate	12518370, 15867486
Adenocarcinoma of Lung	Associate	16116610, 27461624, 32019546, 32154654, 36254009, 38240936, 39766765
Adenolymphoma	Associate	29097817
Adrenal Insufficiency	Associate	23878260
Anemia Sickle Cell	Stimulate	37012663
Arthritis Rheumatoid	Associate	31692815
Ataxia Telangiectasia	Associate	26189429
Atherosclerosis	Associate	14990597
Atypical Squamous Cells of the Cervix	Associate	30043637
Behcet Syndrome	Stimulate	34918882
Bile Duct Neoplasms	Associate	16688800
Bisphosphonate Associated Osteonecrosis of the Jaw	Associate	33274559
Bone Diseases Metabolic	Associate	21448429
Bone Marrow Diseases	Stimulate	32383346
Brain Ischemia	Stimulate	11029398
Brain Neoplasms	Stimulate	18720359
Breast Neoplasms	Associate	10329591, 10551327, 12115372, 12471041, 16080559, 16570043, 17353919, 17912247, 18190720, 19154418, 19940005, 20608938, 21915477, 22020194, 22284579, 22607367, 22906075, 23613720, 23621275, 23981902, 24402572, 25744065, 26104766, 26173622, 26339369, 26656588, 26911617, 30063723, 30255700, 32788048, 33299122, 34793664, 37764312
Breast Neoplasms	Inhibit	38041815
Calcinosis Cutis	Associate	22326461, 24998585
Calcinosis Cutis	Stimulate	30408085
Carcinogenesis	Associate	16394279, 23593187, 24998585, 26339369, 29137038, 31766385
Carcinoma Adenoid Cystic	Associate	21423152
Carcinoma Basal Cell	Associate	24608123, 31692815
Carcinoma Ductal Breast	Associate	16080559
Carcinoma Hepatocellular	Associate	23737988, 24478168, 34845413, 36157115
Carcinoma Intraductal Noninfiltrating	Associate	10329591, 15841074
Carcinoma Merkel Cell	Associate	18408656
Carcinoma Non Small Cell Lung	Associate	10733773, 11461086, 12518370, 15226767, 15785747, 16755294, 18720359, 19197998, 20225197, 20736951, 21870023, 23059773, 24972450, 28925100, 29995950
Carcinoma Ovarian Epithelial	Associate	28591727
Carcinoma Renal Cell	Associate	19302703, 37416763
Carcinoma Small Cell	Associate	22938476
Carcinoma Squamous Cell	Associate	15867486, 20036889, 20827282, 24998585, 27666723, 35935970, 38203550
Cholangiocarcinoma	Associate	18192971, 18395502, 23132676, 26125824
Chondrosarcoma	Associate	27229532, 27345723, 28771226, 30790501
Choroiditis	Associate	16687456
Colorectal Neoplasms	Associate	10970690, 11687953, 14720324, 15484296, 19276682, 20459642, 21448429, 26001393, 26917449, 27713159, 31434836, 35179811, 35208526, 36781122, 37286729
Colorectal Neoplasms	Inhibit	28347226
Coronary Artery Disease	Associate	31692815
Coronary Restenosis	Associate	29557990
Cushing's symphalangism	Stimulate	18190720
Cystic Fibrosis	Stimulate	17382901
Diabetes Mellitus Type 2	Associate	34991588
Diabetic Nephropathies	Stimulate	19145238
Diabetic Nephropathies	Associate	34424825
Diabetic Retinopathy	Associate	26072347, 32836220
Diabetic Retinopathy	Stimulate	34137197
Drug Related Side Effects and Adverse Reactions	Associate	23149913
Dysplastic Nevus Syndrome	Associate	15867486
Endometrial Neoplasms	Associate	27051050
Esophageal Neoplasms	Associate	17695532, 20584281, 22441818, 25640364, 31983128, 37286356
Esophageal Squamous Cell Carcinoma	Associate	15867486, 16874878, 21939555, 22544356, 23125006, 36636641, 37286356
Fibrosis	Associate	24478168
Focal Infection	Associate	25528892
Gastroesophageal Reflux	Associate	23317352
Gastrointestinal Stromal Tumors	Associate	30358224
Giant Cell Tumor of Bone	Associate	35695550
Glaucoma Angle Closure	Associate	26988898
Glaucoma Open Angle	Associate	26988898
Glioblastoma	Associate	26637806, 26753562, 30497369
Glioma	Associate	27334625, 30278527
Glomerulosclerosis Focal Segmental	Stimulate	22038228
Graves Disease	Associate	35865663
Hashimoto Disease	Associate	35865663
Haspeslagh Fryns Muelenaere syndrome	Stimulate	22975656
Heart Diseases	Stimulate	26260101
Hennekam lymphangiectasia lymphedema syndrome	Associate	28985353
Hepatic Veno Occlusive Disease	Stimulate	21330458
Hyperplasia	Stimulate	20584281
Hypoxia	Associate	20215856, 34853621
Hypoxia	Stimulate	22552325
Inflammation	Associate	20827282
Inflammatory Bowel Diseases	Associate	25927528
Insulin Resistance	Inhibit	22471305
Irritable Bowel Syndrome	Associate	25927528
Ischemic Stroke	Associate	35673992
Leukemia	Associate	11877295
Leukemia Myeloid Acute	Associate	11877295, 20522712
Lipedema	Stimulate	32616854
Lung Neoplasms	Associate	22292658, 28623914, 28925100
Lymphangioleiomyomatosis	Associate	19717640
Lymphangioma	Associate	11742043
Lymphatic Diseases	Associate	10970690, 17695532, 18192971
Lymphatic Metastasis	Associate	10390013, 11461086, 14720324, 14760756, 15040017, 15867486, 16755294, 16874878, 17094484, 17465468, 18192971, 18561194, 18974119, 19154418, 19589137, 19940005, 20459642, 20584281, 21986134, 22020194, 22284579, 22441818, 22502683, 22607367, 22906075, 23317352, 23737988, 24608123, 24716913, 24998585, 25640364, 26001393, 26917449, 27666723, 27713159, 28591727, 28771226, 28925100, 29578160, 30255700, 30965022, 31983128, 34643549, 37416763, 38041815, 38250152
Lymphatic Metastasis	Stimulate	11437408, 12610509, 15368324, 15484296, 16482630, 16688800, 17353919, 17409493, 17695532, 18190720, 20225197, 20689828, 21448429, 22366442, 26104766, 26339369, 29137038, 29552758
Lymphatic Vessel Tumors	Associate	10551327, 15867486, 17970036
Lymphedema	Associate	23613720, 24201897, 32513642, 32592340, 36151039
Lymphoma	Associate	16156857
Lymphoma B Cell	Associate	16584091
Lymphoma Large B Cell Diffuse	Associate	17694324
Macular Edema	Associate	26072347
Mastocytosis	Associate	33687603
Melanoma	Inhibit	18616526
Melanoma Cutaneous Malignant	Associate	18561194
Mesangial sclerosis diffuse	Stimulate	22038228
Mesothelioma Malignant	Associate	10487612
Mouth Neoplasms	Associate	23065569, 23593187, 31692815
Mycosis Fungoides	Stimulate	27545193
Nasopharyngeal Carcinoma	Associate	22366442, 26191775, 35072651
Neoplasm Invasiveness	Stimulate	16688800, 26339369
Neoplasm Metastasis	Associate	10329591, 11461086, 12471041, 12910524, 15226772, 17465468, 17912247, 18616526, 19141404, 19638584, 19940005, 21986134, 22020194, 22326461, 22502683, 24841138, 24972450, 26173622, 26191775, 27461624, 27535973, 29552758, 31619709, 33299122, 34643549, 35586989
Neoplasm Metastasis	Stimulate	17353919
Neoplasm Metastasis	Inhibit	23878260
Neoplasms	Associate	10487612, 10551327, 10595926, 11461086, 11687953, 12213723, 12471041, 12610509, 14720324, 14760756, 15166270, 15226767, 15368324, 15466385, 15484296, 15841074, 15870511, 16116610, 16482630, 16491267, 16570043, 16874878, 16984727, 17094484, 17353919, 17465468, 17674352, 17694324, 17912247, 18561194, 18629779, 18630523, 19141404, 19216806, 19302703, 19638584, 19940005, 20225197, 20335228, 20336393, 20565772, 20689828, 20736951, 20827282, 21423152, 21939555, 22020194, 22284579, 22292658, 22716017, 22906075, 22952986, 23111735, 23146280, 23148666, 23149913, 23317352, 23593187, 23866030, 23963849, 24478168, 24608123, 24681953, 24716913, 24858271, 24908332, 24998585, 25277242, 25640364, 25986937, 26173622, 26341082, 26460960, 26637806, 26824419, 26900960, 26911617, 27227358, 27345723, 27713159, 28771226, 28791841, 29137038, 29552758, 30358224, 33299122, 34793664, 34845413, 34895039, 35208526, 36157115, 38041815, 38203550, 39776798, 9665470
Neoplasms	Stimulate	11437408, 20584281, 21986134, 27229532, 28400300
Neoplasms	Inhibit	22049531, 23878260
Neoplasms Cystic Mucinous and Serous	Associate	20103664
Neoplasms Squamous Cell	Associate	25640364
Nephrosis Lipoid	Associate	22038228
Neuroblastoma	Associate	19141404, 20179233
Non functioning pancreatic endocrine tumor	Associate	15466385
Osteosarcoma	Associate	30629798
Ovarian Neoplasms	Associate	12610509, 15368324, 20103664, 28591727, 36766725
Pancreatic Neoplasms	Associate	16482630, 18349830, 20367641, 23651239, 30397360
Peritonitis	Stimulate	12610509
Peritonitis	Associate	15368324
Personality Disorders	Stimulate	15870511
Pigmentary Disorder Reticulate with Systemic Manifestations	Associate	26072347
Pilomatrixoma	Stimulate	38350760
Precancerous Conditions	Associate	31173290
Prodromal Symptoms	Associate	10733773
Prostatic Intraepithelial Neoplasia	Associate	23679318
Prostatic Neoplasms	Associate	16491267, 18974119, 19638584, 22911748, 23679318, 24858271, 30317243, 33509203, 34643549, 37942701
Prostatic Neoplasms Castration Resistant	Associate	27140699
Prostatitis	Associate	10390013
Pterygium	Associate	22910845, 22975656
Pulmonary Arterial Hypertension	Associate	38506416
Rectal Neoplasms	Associate	29552758
Retroperitoneal Neoplasms	Associate	28591727
Sarcoma	Associate	22326461, 23227212
Sarcoma Ewing	Stimulate	23227212
Sarcoma Kaposi	Associate	10594750
Sjogren's Syndrome	Associate	26828975
Skin Diseases	Associate	35393522
Small Cell Lung Carcinoma	Associate	22938476
Squamous Cell Carcinoma of Head and Neck	Associate	15272284, 17674352, 18616526, 18630523, 21936874, 22502683, 22952986, 23593187, 26824419, 30249886, 33096435, 33995379, 36203528, 36425786
Stomach Neoplasms	Associate	14760756, 15040017, 17409493, 17465468, 21272377, 21986134, 22808003, 23866030, 24716913, 24841138, 25884175, 26460960, 28275299, 29393383, 30971501, 33407483, 34895039
Stomach Neoplasms	Stimulate	31173290
Stroke	Associate	35673992
Synovitis	Associate	25889955, 31692815
Tarlov Cysts	Associate	34643549
Tarlov Cysts	Stimulate	38203550
Tertiary Lymphoid Structures	Stimulate	10390013, 29137038
Tertiary Lymphoid Structures	Associate	12910524, 15226772, 18192971, 23059773, 23963849, 29578160
Thymic epithelial tumor	Associate	24908332
Thyroid Cancer Papillary	Stimulate	20306451
Thyroid Cancer Papillary	Associate	29578160
Thyroid Diseases	Associate	20336393
Thyroid Neoplasms	Associate	10595926, 20306451, 22641097
Thyroid Neoplasms	Stimulate	26900960, 35313079
Thyroiditis Autoimmune	Associate	35865663
Triple Negative Breast Neoplasms	Stimulate	23667446
Tuberous Sclerosis	Associate	21767323
Urinary Bladder Neoplasms	Associate	17094484, 22049531, 23111735, 23251617, 25658842, 28423532, 30358224, 30816487, 31650173
Urinary Bladder Neoplasms	Stimulate	23251617, 36434587
Uterine Cervical Dysplasia	Associate	16394279
Uterine Cervical Neoplasms	Associate	11437408, 15226772, 18629779, 19589137, 23963849, 24650367, 28923073, 31478352, 32826853, 34334630, 38211648, 38250152
Uterine Cervical Neoplasms	Stimulate	12189553, 20429915, 29658350
Warts	Associate	31766385