Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7422
Gene name Gene Name - the full gene name approved by the HGNC.	Vascular endothelial growth factor A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	VEGFA
Synonyms (NCBI Gene) Gene synonyms aliases	L-VEGF, MVCD1, VEGF, VPF
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for bot

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs2010963	C>G,T	Risk-factor	Upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs756155710	GACA>-,GACAGACA,GACAGACAGACA	Likely-pathogenic	5 prime UTR variant, coding sequence variant, frameshift variant, upstream transcript variant, genic upstream transcript variant

Show/Hide all(1394)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000722	hsa-miR-302d-3p	Review	19574400
MIRT000721	hsa-miR-373-3p	Review	19574400
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay	19223090
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay	19223090
MIRT004518	hsa-miR-205-5p	Luciferase reporter assay	19238171
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay, Western blot	19144909
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay, Western blot	19144909
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay, Western blot	19144909
MIRT003428	hsa-miR-126-3p	Review	20130964
MIRT004271	hsa-miR-17-5p	ELISA, Luciferase reporter assay	18320040
MIRT004271	hsa-miR-17-5p	ELISA, Luciferase reporter assay	18320040
MIRT004271	hsa-miR-17-5p	ELISA, Luciferase reporter assay	18320040
MIRT004271	hsa-miR-17-5p	ELISA, Luciferase reporter assay	18320040
MIRT004271	hsa-miR-17-5p	ELISA, Luciferase reporter assay	18320040
MIRT004461	hsa-miR-372-3p	ELISA, Luciferase reporter assay	18320040
MIRT004461	hsa-miR-372-3p	ELISA, Luciferase reporter assay	18320040
MIRT004461	hsa-miR-372-3p	ELISA, Luciferase reporter assay	18320040
MIRT004461	hsa-miR-372-3p	ELISA, Luciferase reporter assay	18320040
MIRT004461	hsa-miR-372-3p	ELISA, Luciferase reporter assay	18320040
MIRT003890	hsa-miR-16-5p	ELISA, Luciferase reporter assay	18320040
MIRT004450	hsa-miR-20a-5p	ELISA, Luciferase reporter assay	18320040
MIRT004450	hsa-miR-20a-5p	ELISA, Luciferase reporter assay	18320040
MIRT004451	hsa-miR-20b-5p	ELISA, Luciferase reporter assay	18320040
MIRT004513	hsa-miR-34a-5p	ELISA, Luciferase reporter assay	18320040
MIRT004519	hsa-miR-34b-3p	ELISA, Luciferase reporter assay	18320040
MIRT004055	hsa-miR-93-5p	ELISA, Luciferase reporter assay	18320040
MIRT004465	hsa-miR-106a-5p	ELISA, Luciferase reporter assay	18320040
MIRT004466	hsa-miR-106b-5p	ELISA, Luciferase reporter assay	18320040
MIRT004445	hsa-miR-125a-5p	ELISA, Luciferase reporter assay	18320040
MIRT004272	hsa-miR-150-5p	ELISA, Luciferase reporter assay	18320040
MIRT004273	hsa-miR-195-5p	ELISA, Luciferase reporter assay	18320040
MIRT004278	hsa-miR-330-3p	ELISA, Luciferase reporter assay	18320040
MIRT004277	hsa-miR-378a-3p	ELISA, Luciferase reporter assay	18320040
MIRT004276	hsa-miR-520g-3p	ELISA, Luciferase reporter assay	18320040
MIRT004275	hsa-miR-15a-5p	ELISA, Luciferase reporter assay	18320040
MIRT004274	hsa-miR-15b-5p	ELISA, Luciferase reporter assay	18320040
MIRT003813	hsa-miR-29b-3p	ELISA, Luciferase reporter assay	18320040
MIRT003814	hsa-miR-107	ELISA, Luciferase reporter assay	18320040
MIRT003811	hsa-miR-134-5p	ELISA, Luciferase reporter assay	18320040
MIRT003812	hsa-miR-140-5p	ELISA, Luciferase reporter assay	18320040
MIRT003810	hsa-miR-147a	ELISA, Luciferase reporter assay	18320040
MIRT004518	hsa-miR-205-5p	ELISA, Luciferase reporter assay	18320040
MIRT000722	hsa-miR-302d-3p	ELISA, Luciferase reporter assay	18320040
MIRT004447	hsa-miR-361-5p	ELISA, Luciferase reporter assay	18320040
MIRT000721	hsa-miR-373-3p	ELISA, Luciferase reporter assay	18320040
MIRT004443	hsa-miR-383-5p	ELISA, Luciferase reporter assay	18320040
MIRT004457	hsa-miR-504-5p	ELISA, Luciferase reporter assay	18320040
MIRT004458	hsa-miR-520h	ELISA, Luciferase reporter assay	18320040
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay	15131085
MIRT006215	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	22472569
MIRT006440	hsa-miR-200b-3p	Luciferase reporter assay, Western blot	21544626
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	22510476
MIRT006215	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	22472569
MIRT006440	hsa-miR-200b-3p	Luciferase reporter assay, Western blot	21544626
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	22510476
MIRT006215	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	22472569
MIRT006440	hsa-miR-200b-3p	Luciferase reporter assay, Western blot	21544626
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	22510476
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay, Western blot	21249429
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay, Western blot	21249429
MIRT006771	hsa-miR-200c-3p	Luciferase reporter assay	22685266
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	21885851
MIRT006771	hsa-miR-200c-3p	Luciferase reporter assay, Western blot	22569286
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay	23083510
MIRT004275	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23104180
MIRT004275	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23104180
MIRT004275	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23104180
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	23104180
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	23104180
MIRT007224	hsa-miR-503-5p	Luciferase reporter assay	23352645
MIRT007224	hsa-miR-503-5p	Luciferase reporter assay	23352645
MIRT004275	hsa-miR-15a-5p	Luciferase reporter assay	23233752
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay	23233752
MIRT003890	hsa-miR-16-5p	Luciferase reporter assay	23233752
MIRT016911	hsa-miR-335-5p	Microarray	18185580
MIRT020389	hsa-miR-29c-3p	Sequencing	20371350
MIRT004466	hsa-miR-106b-5p	Microarray	17242205
MIRT004466	hsa-miR-106b-5p	Microarray	17242205
MIRT021081	hsa-miR-190a-5p	Other	21750348
MIRT003428	hsa-miR-126-3p	Reporter assay;Western blot	21249429
MIRT003428	hsa-miR-126-3p	Reporter assay	19223090
MIRT021401	hsa-miR-9-5p	qRT-PCR;Other	20173740
MIRT021711	hsa-miR-133a-3p	Reporter assay	21249429
MIRT004518	hsa-miR-205-5p	Reporter assay	19238171
MIRT027248	hsa-miR-101-3p	Sequencing	20371350
MIRT030717	hsa-miR-21-5p	qRT-PCR	19435867
MIRT030717	hsa-miR-21-5p	Western blot;qRT-PCR	21544242
MIRT003890	hsa-miR-16-5p	Reporter assay	15131085
MIRT004518	hsa-miR-205-5p	U87	22159356
MIRT004518	hsa-miR-205-5p	U87	22159356
MIRT004518	hsa-miR-205-5p	Luciferase reporter assay, qRT-PCR, Western blot	22159356
MIRT006215	hsa-miR-145-5p	Immunoblot, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR	22592534
MIRT053074	hsa-miR-203a-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23867971
MIRT004447	hsa-miR-361-5p	qRT-PCR, Western blot	23128854
MIRT004465	hsa-miR-106a-5p	Microarray	23807165
MIRT004277	hsa-miR-378a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23333942
MIRT053585	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	24209632
MIRT053585	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	24209632
MIRT004447	hsa-miR-361-5p	ELISA, Luciferase reporter assay, qRT-PCR	23166713
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	25428912
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	25428912
MIRT006215	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blotting	24886719
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	23900443
MIRT360955	hsa-miR-185-5p	MDA-MB-231	25448984
MIRT004273	hsa-miR-195-5p	Luciferase reporter assay	23468064
MIRT004273	hsa-miR-195-5p	Luciferase reporter assay	23468064
MIRT027248	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR	23608225
MIRT027248	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR	23608225
MIRT003813	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT003813	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay	24140635
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	24155090
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	24155090
MIRT004518	hsa-miR-205-5p	Luciferase reporter assay	25172656
MIRT169184	hsa-miR-718	Luciferase reporter assay, Western blot	24815691
MIRT169184	hsa-miR-718	Luciferase reporter assay, Western blot	24815691
MIRT169184	hsa-miR-718	Luciferase reporter assay, Western blot	24815691
MIRT169184	hsa-miR-718	Luciferase reporter assay, Western blot	24815691
MIRT003813	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT003813	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT003428	hsa-miR-126-3p	Luciferase reporter assay	24140635
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	24155090
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	24155090
MIRT004518	hsa-miR-205-5p	Luciferase reporter assay	25172656
MIRT169184	hsa-miR-718	Luciferase reporter assay, Western blot	24815691
MIRT169184	hsa-miR-718	Luciferase reporter assay, Western blot	24815691
MIRT169184	hsa-miR-718	Luciferase reporter assay, Western blot	24815691
MIRT169184	hsa-miR-718	Luciferase reporter assay, Western blot	24815691
MIRT004274	hsa-miR-15b-5p	HITS-CLIP	21572407
MIRT100749	hsa-miR-6838-5p	HITS-CLIP	21572407
MIRT100742	hsa-miR-497-5p	HITS-CLIP	21572407
MIRT004273	hsa-miR-195-5p	HITS-CLIP	21572407
MIRT003890	hsa-miR-16-5p	HITS-CLIP	21572407
MIRT004275	hsa-miR-15a-5p	HITS-CLIP	21572407
MIRT100741	hsa-miR-424-5p	HITS-CLIP	21572407
MIRT007224	hsa-miR-503-5p	HITS-CLIP	21572407
MIRT464235	hsa-miR-3662	HITS-CLIP	21572407
MIRT100747	hsa-miR-451b	HITS-CLIP	21572407
MIRT464234	hsa-miR-646	HITS-CLIP	21572407
MIRT100745	hsa-miR-3163	HITS-CLIP	21572407
MIRT100743	hsa-miR-598-5p	HITS-CLIP	21572407
MIRT122988	hsa-miR-423-3p	HITS-CLIP	21572407
MIRT100746	hsa-miR-4524a-5p	HITS-CLIP	21572407
MIRT100748	hsa-miR-4524b-5p	HITS-CLIP	21572407
MIRT100744	hsa-miR-374b-3p	HITS-CLIP	21572407
MIRT100756	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT552967	hsa-miR-8485	HITS-CLIP	21572407
MIRT552966	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT552965	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT552964	hsa-miR-603	HITS-CLIP	21572407
MIRT552963	hsa-miR-4719	HITS-CLIP	21572407
MIRT552962	hsa-miR-3941	HITS-CLIP	21572407
MIRT552961	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT004274	hsa-miR-15b-5p	HITS-CLIP	21572407
MIRT100749	hsa-miR-6838-5p	HITS-CLIP	21572407
MIRT100742	hsa-miR-497-5p	HITS-CLIP	21572407
MIRT004273	hsa-miR-195-5p	HITS-CLIP	21572407
MIRT003890	hsa-miR-16-5p	HITS-CLIP	21572407
MIRT004275	hsa-miR-15a-5p	HITS-CLIP	21572407
MIRT100741	hsa-miR-424-5p	HITS-CLIP	21572407
MIRT007224	hsa-miR-503-5p	HITS-CLIP	21572407
MIRT464235	hsa-miR-3662	HITS-CLIP	21572407
MIRT100747	hsa-miR-451b	HITS-CLIP	21572407
MIRT464234	hsa-miR-646	HITS-CLIP	21572407
MIRT100745	hsa-miR-3163	HITS-CLIP	21572407
MIRT169147	hsa-miR-141-5p	HITS-CLIP	21572407
MIRT100743	hsa-miR-598-5p	HITS-CLIP	21572407
MIRT122988	hsa-miR-423-3p	HITS-CLIP	21572407
MIRT100746	hsa-miR-4524a-5p	HITS-CLIP	21572407
MIRT100748	hsa-miR-4524b-5p	HITS-CLIP	21572407
MIRT707039	hsa-miR-4497	HITS-CLIP	21572407
MIRT100744	hsa-miR-374b-3p	HITS-CLIP	21572407
MIRT651756	hsa-miR-5694	HITS-CLIP	23824327
MIRT651755	hsa-miR-5193	HITS-CLIP	23824327
MIRT651754	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT651753	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT651752	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100743	hsa-miR-598-5p	PAR-CLIP	20371350
MIRT122988	hsa-miR-423-3p	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100743	hsa-miR-598-5p	PAR-CLIP	20371350
MIRT122988	hsa-miR-423-3p	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100743	hsa-miR-598-5p	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100743	hsa-miR-598-5p	PAR-CLIP	20371350
MIRT122988	hsa-miR-423-3p	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT020389	hsa-miR-29c-3p	PAR-CLIP	20371350
MIRT003813	hsa-miR-29b-3p	PAR-CLIP	20371350
MIRT053585	hsa-miR-29a-3p	PAR-CLIP	20371350
MIRT464233	hsa-miR-5692a	PAR-CLIP	20371350
MIRT317923	hsa-miR-3646	PAR-CLIP	20371350
MIRT317922	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT464232	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT464231	hsa-miR-5688	PAR-CLIP	20371350
MIRT464230	hsa-miR-7-1-3p	PAR-CLIP	20371350
MIRT464229	hsa-miR-7-2-3p	PAR-CLIP	20371350
MIRT464228	hsa-miR-6871-3p	PAR-CLIP	20371350
MIRT317921	hsa-miR-95-5p	PAR-CLIP	20371350
MIRT317924	hsa-miR-5682	PAR-CLIP	20371350
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100743	hsa-miR-598-5p	PAR-CLIP	20371350
MIRT122988	hsa-miR-423-3p	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT552970	hsa-miR-4735-5p	PAR-CLIP	21572407
MIRT003428	hsa-miR-126-3p	PAR-CLIP	21572407
MIRT552969	hsa-miR-4263	PAR-CLIP	21572407
MIRT552968	hsa-miR-576-5p	PAR-CLIP	21572407
MIRT100756	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT552967	hsa-miR-8485	PAR-CLIP	21572407
MIRT552966	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT552965	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT552964	hsa-miR-603	PAR-CLIP	21572407
MIRT552963	hsa-miR-4719	PAR-CLIP	21572407
MIRT552962	hsa-miR-3941	PAR-CLIP	21572407
MIRT552961	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT020389	hsa-miR-29c-3p	PAR-CLIP	21572407
MIRT003813	hsa-miR-29b-3p	PAR-CLIP	21572407
MIRT053585	hsa-miR-29a-3p	PAR-CLIP	21572407
MIRT464233	hsa-miR-5692a	PAR-CLIP	21572407
MIRT317923	hsa-miR-3646	PAR-CLIP	21572407
MIRT317922	hsa-miR-1252-3p	PAR-CLIP	21572407
MIRT464232	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT464231	hsa-miR-5688	PAR-CLIP	21572407
MIRT464230	hsa-miR-7-1-3p	PAR-CLIP	21572407
MIRT464229	hsa-miR-7-2-3p	PAR-CLIP	21572407
MIRT464228	hsa-miR-6871-3p	PAR-CLIP	21572407
MIRT317921	hsa-miR-95-5p	PAR-CLIP	21572407
MIRT317924	hsa-miR-5682	PAR-CLIP	21572407
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT100742	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT004273	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT003890	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT100741	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT007224	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT464235	hsa-miR-3662	PAR-CLIP	21572407
MIRT100747	hsa-miR-451b	PAR-CLIP	21572407
MIRT464234	hsa-miR-646	PAR-CLIP	21572407
MIRT100745	hsa-miR-3163	PAR-CLIP	21572407
MIRT100743	hsa-miR-598-5p	PAR-CLIP	21572407
MIRT122988	hsa-miR-423-3p	PAR-CLIP	21572407
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	21572407
MIRT020389	hsa-miR-29c-3p	PAR-CLIP	21572407
MIRT003813	hsa-miR-29b-3p	PAR-CLIP	21572407
MIRT053585	hsa-miR-29a-3p	PAR-CLIP	21572407
MIRT464233	hsa-miR-5692a	PAR-CLIP	21572407
MIRT317923	hsa-miR-3646	PAR-CLIP	21572407
MIRT317922	hsa-miR-1252-3p	PAR-CLIP	21572407
MIRT464232	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT464231	hsa-miR-5688	PAR-CLIP	21572407
MIRT464230	hsa-miR-7-1-3p	PAR-CLIP	21572407
MIRT464229	hsa-miR-7-2-3p	PAR-CLIP	21572407
MIRT464228	hsa-miR-6871-3p	PAR-CLIP	21572407
MIRT317921	hsa-miR-95-5p	PAR-CLIP	21572407
MIRT317924	hsa-miR-5682	PAR-CLIP	21572407
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	22012620
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	22012620
MIRT100742	hsa-miR-497-5p	PAR-CLIP	22012620
MIRT004273	hsa-miR-195-5p	PAR-CLIP	22012620
MIRT003890	hsa-miR-16-5p	PAR-CLIP	22012620
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	22012620
MIRT100741	hsa-miR-424-5p	PAR-CLIP	22012620
MIRT007224	hsa-miR-503-5p	PAR-CLIP	22012620
MIRT464235	hsa-miR-3662	PAR-CLIP	22012620
MIRT100747	hsa-miR-451b	PAR-CLIP	22012620
MIRT464234	hsa-miR-646	PAR-CLIP	22012620
MIRT100745	hsa-miR-3163	PAR-CLIP	22012620
MIRT100743	hsa-miR-598-5p	PAR-CLIP	22012620
MIRT122988	hsa-miR-423-3p	PAR-CLIP	22012620
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	22012620
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	22012620
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	22012620
MIRT169150	hsa-miR-299-3p	PAR-CLIP	23446348
MIRT100756	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT520234	hsa-miR-369-3p	PAR-CLIP	23446348
MIRT520233	hsa-miR-5692b	PAR-CLIP	23446348
MIRT520232	hsa-miR-5692c	PAR-CLIP	23446348
MIRT520231	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT520230	hsa-miR-363-5p	PAR-CLIP	23446348
MIRT520229	hsa-miR-6745	PAR-CLIP	23446348
MIRT169216	hsa-miR-6756-5p	PAR-CLIP	23446348
MIRT169218	hsa-miR-6766-5p	PAR-CLIP	23446348
MIRT520228	hsa-miR-1293	PAR-CLIP	23446348
MIRT520227	hsa-miR-4483	PAR-CLIP	23446348
MIRT169219	hsa-miR-6769a-5p	PAR-CLIP	23446348
MIRT169225	hsa-miR-6769b-5p	PAR-CLIP	23446348
MIRT520226	hsa-miR-567	PAR-CLIP	23446348
MIRT169215	hsa-miR-6748-5p	PAR-CLIP	23446348
MIRT520225	hsa-miR-6793-5p	PAR-CLIP	23446348
MIRT520224	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT520223	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT169196	hsa-miR-3924	PAR-CLIP	23446348
MIRT169172	hsa-miR-297	PAR-CLIP	23446348
MIRT169217	hsa-miR-6759-5p	PAR-CLIP	23446348
MIRT100755	hsa-miR-568	PAR-CLIP	23446348
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT464235	hsa-miR-3662	PAR-CLIP	23446348
MIRT100747	hsa-miR-451b	PAR-CLIP	23446348
MIRT464234	hsa-miR-646	PAR-CLIP	23446348
MIRT100745	hsa-miR-3163	PAR-CLIP	23446348
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23446348
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23446348
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT464235	hsa-miR-3662	PAR-CLIP	23446348
MIRT100747	hsa-miR-451b	PAR-CLIP	23446348
MIRT464234	hsa-miR-646	PAR-CLIP	23446348
MIRT100745	hsa-miR-3163	PAR-CLIP	23446348
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23446348
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23446348
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT464235	hsa-miR-3662	PAR-CLIP	23446348
MIRT100747	hsa-miR-451b	PAR-CLIP	23446348
MIRT464234	hsa-miR-646	PAR-CLIP	23446348
MIRT100745	hsa-miR-3163	PAR-CLIP	23446348
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23446348
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23446348
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	24398324
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	24398324
MIRT100742	hsa-miR-497-5p	PAR-CLIP	24398324
MIRT004273	hsa-miR-195-5p	PAR-CLIP	24398324
MIRT003890	hsa-miR-16-5p	PAR-CLIP	24398324
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	24398324
MIRT100741	hsa-miR-424-5p	PAR-CLIP	24398324
MIRT007224	hsa-miR-503-5p	PAR-CLIP	24398324
MIRT464235	hsa-miR-3662	PAR-CLIP	24398324
MIRT100747	hsa-miR-451b	PAR-CLIP	24398324
MIRT464234	hsa-miR-646	PAR-CLIP	24398324
MIRT100745	hsa-miR-3163	PAR-CLIP	24398324
MIRT100743	hsa-miR-598-5p	PAR-CLIP	24398324
MIRT122988	hsa-miR-423-3p	PAR-CLIP	24398324
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	24398324
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	24398324
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	24398324
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT464235	hsa-miR-3662	PAR-CLIP	23592263
MIRT100747	hsa-miR-451b	PAR-CLIP	23592263
MIRT464234	hsa-miR-646	PAR-CLIP	23592263
MIRT100745	hsa-miR-3163	PAR-CLIP	23592263
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23592263
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23592263
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23592263
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT464235	hsa-miR-3662	PAR-CLIP	23592263
MIRT100747	hsa-miR-451b	PAR-CLIP	23592263
MIRT464234	hsa-miR-646	PAR-CLIP	23592263
MIRT100745	hsa-miR-3163	PAR-CLIP	23592263
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23592263
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23592263
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23592263
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT464235	hsa-miR-3662	PAR-CLIP	23592263
MIRT100747	hsa-miR-451b	PAR-CLIP	23592263
MIRT464234	hsa-miR-646	PAR-CLIP	23592263
MIRT100745	hsa-miR-3163	PAR-CLIP	23592263
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23592263
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23592263
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23592263
MIRT020389	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT003813	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT053585	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT464233	hsa-miR-5692a	PAR-CLIP	23592263
MIRT317923	hsa-miR-3646	PAR-CLIP	23592263
MIRT317922	hsa-miR-1252-3p	PAR-CLIP	23592263
MIRT464232	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT464231	hsa-miR-5688	PAR-CLIP	23592263
MIRT464230	hsa-miR-7-1-3p	PAR-CLIP	23592263
MIRT464229	hsa-miR-7-2-3p	PAR-CLIP	23592263
MIRT464228	hsa-miR-6871-3p	PAR-CLIP	23592263
MIRT317921	hsa-miR-95-5p	PAR-CLIP	23592263
MIRT317924	hsa-miR-5682	PAR-CLIP	23592263
MIRT004275	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT004274	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT003890	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT004273	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT004518	hsa-miR-205-5p	Luciferase reporter assay, qRT-PCR, Western blot	26396534
MIRT004275	hsa-miR-15a-5p	Chromatin immunoprecipitation, Immunoblot, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR	27322147
MIRT731842	hsa-miR-1-3p	Luciferase reporter assay, qRT-PCR, Western blot	27777493
MIRT731842	hsa-miR-1-3p	Luciferase reporter assay, qRT-PCR, Western blot	27777493
MIRT004445	hsa-miR-125a-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	26398444
MIRT004445	hsa-miR-125a-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	26398444
MIRT006440	hsa-miR-200b-3p	Luciferase reporter assay	28122882
MIRT732343	hsa-miR-125a-3p	SGC7901	26398444
MIRT732343	hsa-miR-125a-3p	SGC7901	26398444
MIRT006440	hsa-miR-200b-3p	qRT-PCR, Western blot	25884496
MIRT053585	hsa-miR-29a-3p	Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27000664
MIRT053585	hsa-miR-29a-3p	Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27000664
MIRT020389	hsa-miR-29c-3p	Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27000664
MIRT020389	hsa-miR-29c-3p	Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27000664
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	26191163
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	26191163
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	26191163
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	26191163
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	26191163
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	26191163
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	26191163
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	26191163
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	26191163
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay	26191163
MIRT003813	hsa-miR-29b-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	28222438
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay, qRT-PCR, Western blot	26402430
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay, qRT-PCR, Western blot	26402430
MIRT004447	hsa-miR-361-5p	Luciferase reporter assay, Western blot	27641667
MIRT004451	hsa-miR-20b-5p	Luciferase reporter assay, qRT-PCR, Western blot	26612965
MIRT438498	hsa-miR-199a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26783726
MIRT520223	hsa-miR-374b-5p	LacZ reporter assay	26713602
MIRT520223	hsa-miR-374b-5p	LacZ reporter assay	26713602
MIRT520223	hsa-miR-374b-5p	LacZ reporter assay	26713602
MIRT520223	hsa-miR-374b-5p	LacZ reporter assay	26713602
MIRT731842	hsa-miR-1-3p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	28493075
MIRT731842	hsa-miR-1-3p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	28493075
MIRT731842	hsa-miR-1-3p	ELISA, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27541266
MIRT731842	hsa-miR-1-3p	ELISA, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27541266
MIRT755306	hsa-miR-206	ELISA, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27541266
MIRT755306	hsa-miR-206	ELISA, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27541266
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay	27035554
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay	27035554
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay	27035554
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay	27035554
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay	27035554
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay, Western blot	27035554
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay, Western blot	27035554
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay, Western blot	27035554
MIRT003812	hsa-miR-140-5p	Luciferase reporter assay, Western blot	27035554
MIRT004275	hsa-miR-15a-5p	ELISA, Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27916780
MIRT004275	hsa-miR-15a-5p	ELISA, Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27916780
MIRT732064	hsa-miR-101-3p	Luciferase reporter assay	25658842
MIRT732064	hsa-miR-101-3p	Luciferase reporter assay	25658842
MIRT004055	hsa-miR-93-5p	Luciferase reporter assay, qRT-PCR, Western blot	26175939
MIRT004055	hsa-miR-93-5p	Luciferase reporter assay, qRT-PCR, Western blot	26175939
MIRT004273	hsa-miR-195-5p	ELISA, Luciferase reporter assay	26823724
MIRT004273	hsa-miR-195-5p	ELISA, Luciferase reporter assay	26823724
MIRT732741	hsa-miR-452-5p	Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR, Western blotting	31652600
MIRT004518	hsa-miR-205-5p	Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	32065361
MIRT003428	hsa-miR-126-3p	Immunohistochemistry (IHC), In situ hybridization, Microarray	34055877
MIRT733237	hsa-miR-20b-3p	Immunohistochemistry (IHC), In situ hybridization, Microarray	34055877
MIRT733238	hsa-miR-106a-3p	Immunohistochemistry (IHC), In situ hybridization, Microarray	34055877
MIRT100747	hsa-miR-451b	Luciferase reporter assay, qRT-PCR, Western blotting	31922013
MIRT360955	hsa-miR-185-5p	Immunocytochemistry (ICC), Microarray, qRT-PCR	33916610
MIRT464234	hsa-miR-646	Luciferase reporter assay, qRT-PCR, Western blotting	32782496
MIRT003428	hsa-miR-126-3p	Immunofluorescence, Immunohistochemistry (IHC), qRT-PCR, Western blotting	32705156
MIRT734928	hsa-miR-214-3p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	33280526
MIRT735115	hsa-miR-885-3p	qRT-PCR	31776299
MIRT004271	hsa-miR-17-5p	qRT-PCR	31776299
MIRT520223	hsa-miR-374b-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunocytochemistry (ICC)	32617008
MIRT003428	hsa-miR-126-3p	qRT-PCR	32425976
MIRT735343	hsa-miR-590-3p	Luciferase reporter assay, qRT-PCR, ELISA	32277427
MIRT004451	hsa-miR-20b-5p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	33469291
MIRT735579	hsa-miR-4316	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	32123520
MIRT735804	hsa-miR-199b-5p	Western blotting, qRT-PCR	32178301
MIRT003813	hsa-miR-29b-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR	31737629
MIRT737019	hsa-miR-377-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33906524
MIRT737165	hsa-miR-29b-2-5p	Western blotting, Microarray, qRT-PCR	33262463
MIRT004274	hsa-miR-15b-5p	HITS-CLIP	21572407
MIRT100749	hsa-miR-6838-5p	HITS-CLIP	21572407
MIRT100742	hsa-miR-497-5p	HITS-CLIP	21572407
MIRT004273	hsa-miR-195-5p	HITS-CLIP	21572407
MIRT003890	hsa-miR-16-5p	HITS-CLIP	21572407
MIRT004275	hsa-miR-15a-5p	HITS-CLIP	21572407
MIRT100741	hsa-miR-424-5p	HITS-CLIP	21572407
MIRT007224	hsa-miR-503-5p	HITS-CLIP	21572407
MIRT464235	hsa-miR-3662	HITS-CLIP	21572407
MIRT100747	hsa-miR-451b	HITS-CLIP	21572407
MIRT464234	hsa-miR-646	HITS-CLIP	21572407
MIRT100745	hsa-miR-3163	HITS-CLIP	21572407
MIRT100743	hsa-miR-598-5p	HITS-CLIP	21572407
MIRT122988	hsa-miR-423-3p	HITS-CLIP	21572407
MIRT100746	hsa-miR-4524a-5p	HITS-CLIP	21572407
MIRT100748	hsa-miR-4524b-5p	HITS-CLIP	21572407
MIRT100744	hsa-miR-374b-3p	HITS-CLIP	21572407
MIRT100756	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT552967	hsa-miR-8485	HITS-CLIP	21572407
MIRT552966	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT552965	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT552964	hsa-miR-603	HITS-CLIP	21572407
MIRT552963	hsa-miR-4719	HITS-CLIP	21572407
MIRT552962	hsa-miR-3941	HITS-CLIP	21572407
MIRT552961	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT004274	hsa-miR-15b-5p	HITS-CLIP	21572407
MIRT100749	hsa-miR-6838-5p	HITS-CLIP	21572407
MIRT100742	hsa-miR-497-5p	HITS-CLIP	21572407
MIRT004273	hsa-miR-195-5p	HITS-CLIP	21572407
MIRT003890	hsa-miR-16-5p	HITS-CLIP	21572407
MIRT004275	hsa-miR-15a-5p	HITS-CLIP	21572407
MIRT100741	hsa-miR-424-5p	HITS-CLIP	21572407
MIRT007224	hsa-miR-503-5p	HITS-CLIP	21572407
MIRT464235	hsa-miR-3662	HITS-CLIP	21572407
MIRT100747	hsa-miR-451b	HITS-CLIP	21572407
MIRT464234	hsa-miR-646	HITS-CLIP	21572407
MIRT100745	hsa-miR-3163	HITS-CLIP	21572407
MIRT169147	hsa-miR-141-5p	HITS-CLIP	21572407
MIRT100743	hsa-miR-598-5p	HITS-CLIP	21572407
MIRT122988	hsa-miR-423-3p	HITS-CLIP	21572407
MIRT100746	hsa-miR-4524a-5p	HITS-CLIP	21572407
MIRT100748	hsa-miR-4524b-5p	HITS-CLIP	21572407
MIRT707039	hsa-miR-4497	HITS-CLIP	21572407
MIRT100744	hsa-miR-374b-3p	HITS-CLIP	21572407
MIRT651756	hsa-miR-5694	HITS-CLIP	23824327
MIRT651755	hsa-miR-5193	HITS-CLIP	23824327
MIRT651754	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT651753	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT651752	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100743	hsa-miR-598-5p	PAR-CLIP	20371350
MIRT122988	hsa-miR-423-3p	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100743	hsa-miR-598-5p	PAR-CLIP	20371350
MIRT122988	hsa-miR-423-3p	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100743	hsa-miR-598-5p	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100743	hsa-miR-598-5p	PAR-CLIP	20371350
MIRT122988	hsa-miR-423-3p	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT020389	hsa-miR-29c-3p	PAR-CLIP	20371350
MIRT003813	hsa-miR-29b-3p	PAR-CLIP	20371350
MIRT053585	hsa-miR-29a-3p	PAR-CLIP	20371350
MIRT464233	hsa-miR-5692a	PAR-CLIP	20371350
MIRT317923	hsa-miR-3646	PAR-CLIP	20371350
MIRT317922	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT464232	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT464231	hsa-miR-5688	PAR-CLIP	20371350
MIRT464230	hsa-miR-7-1-3p	PAR-CLIP	20371350
MIRT464229	hsa-miR-7-2-3p	PAR-CLIP	20371350
MIRT464228	hsa-miR-6871-3p	PAR-CLIP	20371350
MIRT317921	hsa-miR-95-5p	PAR-CLIP	20371350
MIRT317924	hsa-miR-5682	PAR-CLIP	20371350
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT100742	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT004273	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT003890	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT100741	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT007224	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT464235	hsa-miR-3662	PAR-CLIP	20371350
MIRT100747	hsa-miR-451b	PAR-CLIP	20371350
MIRT464234	hsa-miR-646	PAR-CLIP	20371350
MIRT100745	hsa-miR-3163	PAR-CLIP	20371350
MIRT100743	hsa-miR-598-5p	PAR-CLIP	20371350
MIRT122988	hsa-miR-423-3p	PAR-CLIP	20371350
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT552970	hsa-miR-4735-5p	PAR-CLIP	21572407
MIRT003428	hsa-miR-126-3p	PAR-CLIP	21572407
MIRT552969	hsa-miR-4263	PAR-CLIP	21572407
MIRT552968	hsa-miR-576-5p	PAR-CLIP	21572407
MIRT100756	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT552967	hsa-miR-8485	PAR-CLIP	21572407
MIRT552966	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT552965	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT552964	hsa-miR-603	PAR-CLIP	21572407
MIRT552963	hsa-miR-4719	PAR-CLIP	21572407
MIRT552962	hsa-miR-3941	PAR-CLIP	21572407
MIRT552961	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT020389	hsa-miR-29c-3p	PAR-CLIP	21572407
MIRT003813	hsa-miR-29b-3p	PAR-CLIP	21572407
MIRT053585	hsa-miR-29a-3p	PAR-CLIP	21572407
MIRT464233	hsa-miR-5692a	PAR-CLIP	21572407
MIRT317923	hsa-miR-3646	PAR-CLIP	21572407
MIRT317922	hsa-miR-1252-3p	PAR-CLIP	21572407
MIRT464232	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT464231	hsa-miR-5688	PAR-CLIP	21572407
MIRT464230	hsa-miR-7-1-3p	PAR-CLIP	21572407
MIRT464229	hsa-miR-7-2-3p	PAR-CLIP	21572407
MIRT464228	hsa-miR-6871-3p	PAR-CLIP	21572407
MIRT317921	hsa-miR-95-5p	PAR-CLIP	21572407
MIRT317924	hsa-miR-5682	PAR-CLIP	21572407
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT100742	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT004273	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT003890	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT100741	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT007224	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT464235	hsa-miR-3662	PAR-CLIP	21572407
MIRT100747	hsa-miR-451b	PAR-CLIP	21572407
MIRT464234	hsa-miR-646	PAR-CLIP	21572407
MIRT100745	hsa-miR-3163	PAR-CLIP	21572407
MIRT100743	hsa-miR-598-5p	PAR-CLIP	21572407
MIRT122988	hsa-miR-423-3p	PAR-CLIP	21572407
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	21572407
MIRT020389	hsa-miR-29c-3p	PAR-CLIP	21572407
MIRT003813	hsa-miR-29b-3p	PAR-CLIP	21572407
MIRT053585	hsa-miR-29a-3p	PAR-CLIP	21572407
MIRT464233	hsa-miR-5692a	PAR-CLIP	21572407
MIRT317923	hsa-miR-3646	PAR-CLIP	21572407
MIRT317922	hsa-miR-1252-3p	PAR-CLIP	21572407
MIRT464232	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT464231	hsa-miR-5688	PAR-CLIP	21572407
MIRT464230	hsa-miR-7-1-3p	PAR-CLIP	21572407
MIRT464229	hsa-miR-7-2-3p	PAR-CLIP	21572407
MIRT464228	hsa-miR-6871-3p	PAR-CLIP	21572407
MIRT317921	hsa-miR-95-5p	PAR-CLIP	21572407
MIRT317924	hsa-miR-5682	PAR-CLIP	21572407
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	22012620
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	22012620
MIRT100742	hsa-miR-497-5p	PAR-CLIP	22012620
MIRT004273	hsa-miR-195-5p	PAR-CLIP	22012620
MIRT003890	hsa-miR-16-5p	PAR-CLIP	22012620
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	22012620
MIRT100741	hsa-miR-424-5p	PAR-CLIP	22012620
MIRT007224	hsa-miR-503-5p	PAR-CLIP	22012620
MIRT464235	hsa-miR-3662	PAR-CLIP	22012620
MIRT100747	hsa-miR-451b	PAR-CLIP	22012620
MIRT464234	hsa-miR-646	PAR-CLIP	22012620
MIRT100745	hsa-miR-3163	PAR-CLIP	22012620
MIRT100743	hsa-miR-598-5p	PAR-CLIP	22012620
MIRT122988	hsa-miR-423-3p	PAR-CLIP	22012620
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	22012620
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	22012620
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	22012620
MIRT169150	hsa-miR-299-3p	PAR-CLIP	23446348
MIRT100756	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT520234	hsa-miR-369-3p	PAR-CLIP	23446348
MIRT520233	hsa-miR-5692b	PAR-CLIP	23446348
MIRT520232	hsa-miR-5692c	PAR-CLIP	23446348
MIRT520231	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT520230	hsa-miR-363-5p	PAR-CLIP	23446348
MIRT520229	hsa-miR-6745	PAR-CLIP	23446348
MIRT169216	hsa-miR-6756-5p	PAR-CLIP	23446348
MIRT169218	hsa-miR-6766-5p	PAR-CLIP	23446348
MIRT520228	hsa-miR-1293	PAR-CLIP	23446348
MIRT520227	hsa-miR-4483	PAR-CLIP	23446348
MIRT169219	hsa-miR-6769a-5p	PAR-CLIP	23446348
MIRT169225	hsa-miR-6769b-5p	PAR-CLIP	23446348
MIRT520226	hsa-miR-567	PAR-CLIP	23446348
MIRT169215	hsa-miR-6748-5p	PAR-CLIP	23446348
MIRT520225	hsa-miR-6793-5p	PAR-CLIP	23446348
MIRT520224	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT520223	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT169196	hsa-miR-3924	PAR-CLIP	23446348
MIRT169172	hsa-miR-297	PAR-CLIP	23446348
MIRT169217	hsa-miR-6759-5p	PAR-CLIP	23446348
MIRT100755	hsa-miR-568	PAR-CLIP	23446348
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT464235	hsa-miR-3662	PAR-CLIP	23446348
MIRT100747	hsa-miR-451b	PAR-CLIP	23446348
MIRT464234	hsa-miR-646	PAR-CLIP	23446348
MIRT100745	hsa-miR-3163	PAR-CLIP	23446348
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23446348
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23446348
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT464235	hsa-miR-3662	PAR-CLIP	23446348
MIRT100747	hsa-miR-451b	PAR-CLIP	23446348
MIRT464234	hsa-miR-646	PAR-CLIP	23446348
MIRT100745	hsa-miR-3163	PAR-CLIP	23446348
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23446348
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23446348
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT464235	hsa-miR-3662	PAR-CLIP	23446348
MIRT100747	hsa-miR-451b	PAR-CLIP	23446348
MIRT464234	hsa-miR-646	PAR-CLIP	23446348
MIRT100745	hsa-miR-3163	PAR-CLIP	23446348
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23446348
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23446348
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	24398324
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	24398324
MIRT100742	hsa-miR-497-5p	PAR-CLIP	24398324
MIRT004273	hsa-miR-195-5p	PAR-CLIP	24398324
MIRT003890	hsa-miR-16-5p	PAR-CLIP	24398324
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	24398324
MIRT100741	hsa-miR-424-5p	PAR-CLIP	24398324
MIRT007224	hsa-miR-503-5p	PAR-CLIP	24398324
MIRT464235	hsa-miR-3662	PAR-CLIP	24398324
MIRT100747	hsa-miR-451b	PAR-CLIP	24398324
MIRT464234	hsa-miR-646	PAR-CLIP	24398324
MIRT100745	hsa-miR-3163	PAR-CLIP	24398324
MIRT100743	hsa-miR-598-5p	PAR-CLIP	24398324
MIRT122988	hsa-miR-423-3p	PAR-CLIP	24398324
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	24398324
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	24398324
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	24398324
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT464235	hsa-miR-3662	PAR-CLIP	23592263
MIRT100747	hsa-miR-451b	PAR-CLIP	23592263
MIRT464234	hsa-miR-646	PAR-CLIP	23592263
MIRT100745	hsa-miR-3163	PAR-CLIP	23592263
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23592263
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23592263
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23592263
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT464235	hsa-miR-3662	PAR-CLIP	23592263
MIRT100747	hsa-miR-451b	PAR-CLIP	23592263
MIRT464234	hsa-miR-646	PAR-CLIP	23592263
MIRT100745	hsa-miR-3163	PAR-CLIP	23592263
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23592263
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23592263
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23592263
MIRT004274	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT100749	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT100742	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT004273	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT003890	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT004275	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT100741	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT007224	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT464235	hsa-miR-3662	PAR-CLIP	23592263
MIRT100747	hsa-miR-451b	PAR-CLIP	23592263
MIRT464234	hsa-miR-646	PAR-CLIP	23592263
MIRT100745	hsa-miR-3163	PAR-CLIP	23592263
MIRT100743	hsa-miR-598-5p	PAR-CLIP	23592263
MIRT122988	hsa-miR-423-3p	PAR-CLIP	23592263
MIRT100746	hsa-miR-4524a-5p	PAR-CLIP	23592263
MIRT100748	hsa-miR-4524b-5p	PAR-CLIP	23592263
MIRT100744	hsa-miR-374b-3p	PAR-CLIP	23592263
MIRT020389	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT003813	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT053585	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT464233	hsa-miR-5692a	PAR-CLIP	23592263
MIRT317923	hsa-miR-3646	PAR-CLIP	23592263
MIRT317922	hsa-miR-1252-3p	PAR-CLIP	23592263
MIRT464232	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT464231	hsa-miR-5688	PAR-CLIP	23592263
MIRT464230	hsa-miR-7-1-3p	PAR-CLIP	23592263
MIRT464229	hsa-miR-7-2-3p	PAR-CLIP	23592263
MIRT464228	hsa-miR-6871-3p	PAR-CLIP	23592263
MIRT317921	hsa-miR-95-5p	PAR-CLIP	23592263
MIRT317924	hsa-miR-5682	PAR-CLIP	23592263
MIRT755306	hsa-miR-206	Luciferase reporter assay, Western blotting, qRT-PCR	34697590
MIRT004273	hsa-miR-195-5p	Luciferase reporter assay, Western blotting, qRT-PCR	34712495
MIRT006215	hsa-miR-145-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35722425
MIRT003428	hsa-miR-126-3p	Microarray, qRT-PCR	35816043
MIRT004275	hsa-miR-15a-5p	Microarray, qRT-PCR	35816043
MIRT004518	hsa-miR-205-5p	Microarray, qRT-PCR	35816043
MIRT004443	hsa-miR-383-5p	Luciferase reporter assay, Western blotting, qRT-PCR	37592783
MIRT756092	hsa-miR-23a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	34765018
MIRT003813	hsa-miR-29b-3p	Luciferase reporter assay, Western blotting, qRT-PCR	37026504
MIRT1483795	hsa-miR-1343	CLIP-seq
MIRT1483796	hsa-miR-1976	CLIP-seq
MIRT1483797	hsa-miR-24	CLIP-seq
MIRT1483798	hsa-miR-2467-5p	CLIP-seq
MIRT1483799	hsa-miR-3132	CLIP-seq
MIRT1483800	hsa-miR-3545-5p	CLIP-seq
MIRT1483801	hsa-miR-3661	CLIP-seq
MIRT1483802	hsa-miR-4256	CLIP-seq
MIRT1483803	hsa-miR-4279	CLIP-seq
MIRT1483804	hsa-miR-4446-3p	CLIP-seq
MIRT1483805	hsa-miR-4451	CLIP-seq
MIRT1483806	hsa-miR-4460	CLIP-seq
MIRT1483807	hsa-miR-4492	CLIP-seq
MIRT1483808	hsa-miR-4498	CLIP-seq
MIRT1483809	hsa-miR-4505	CLIP-seq
MIRT1483810	hsa-miR-4652-3p	CLIP-seq
MIRT1483811	hsa-miR-4685-5p	CLIP-seq
MIRT1483812	hsa-miR-629	CLIP-seq
MIRT1483813	hsa-miR-631	CLIP-seq
MIRT1483814	hsa-miR-637	CLIP-seq
MIRT1483815	hsa-miR-762	CLIP-seq
MIRT1483816	hsa-miR-1	CLIP-seq
MIRT1483817	hsa-miR-106a	CLIP-seq
MIRT1483818	hsa-miR-106b	CLIP-seq
MIRT1483819	hsa-miR-1249	CLIP-seq
MIRT1483795	hsa-miR-1343	CLIP-seq
MIRT1483820	hsa-miR-1470	CLIP-seq
MIRT1483821	hsa-miR-15a	CLIP-seq
MIRT1483822	hsa-miR-15b	CLIP-seq
MIRT1483823	hsa-miR-16	CLIP-seq
MIRT1483824	hsa-miR-17	CLIP-seq
MIRT1483825	hsa-miR-1825	CLIP-seq
MIRT1483826	hsa-miR-185	CLIP-seq
MIRT1483827	hsa-miR-195	CLIP-seq
MIRT1483796	hsa-miR-1976	CLIP-seq
MIRT1483828	hsa-miR-20a	CLIP-seq
MIRT1483829	hsa-miR-20b	CLIP-seq
MIRT1483830	hsa-miR-2115	CLIP-seq
MIRT1483831	hsa-miR-302a	CLIP-seq
MIRT1483832	hsa-miR-302b	CLIP-seq
MIRT1483833	hsa-miR-302c	CLIP-seq
MIRT1483834	hsa-miR-302d	CLIP-seq
MIRT1483835	hsa-miR-302e	CLIP-seq
MIRT1483836	hsa-miR-3150a-3p	CLIP-seq
MIRT1483837	hsa-miR-3152-3p	CLIP-seq
MIRT1483838	hsa-miR-3160-3p	CLIP-seq
MIRT1483839	hsa-miR-3175	CLIP-seq
MIRT1483840	hsa-miR-3194-3p	CLIP-seq
MIRT1483841	hsa-miR-3202	CLIP-seq
MIRT1483842	hsa-miR-3616-3p	CLIP-seq
MIRT1483843	hsa-miR-3659	CLIP-seq
MIRT1483844	hsa-miR-3671	CLIP-seq
MIRT1483845	hsa-miR-3687	CLIP-seq
MIRT1483846	hsa-miR-372	CLIP-seq
MIRT1483847	hsa-miR-373	CLIP-seq
MIRT1483848	hsa-miR-377	CLIP-seq
MIRT1483849	hsa-miR-3908	CLIP-seq
MIRT1483850	hsa-miR-3942-5p	CLIP-seq
MIRT1483851	hsa-miR-3978	CLIP-seq
MIRT1483852	hsa-miR-424	CLIP-seq
MIRT1483853	hsa-miR-4261	CLIP-seq
MIRT1483854	hsa-miR-4270	CLIP-seq
MIRT1483855	hsa-miR-4274	CLIP-seq
MIRT1483856	hsa-miR-4290	CLIP-seq
MIRT1483857	hsa-miR-4294	CLIP-seq
MIRT1483858	hsa-miR-4306	CLIP-seq
MIRT1483859	hsa-miR-4436b-3p	CLIP-seq
MIRT1483860	hsa-miR-4441	CLIP-seq
MIRT1483861	hsa-miR-4442	CLIP-seq
MIRT1483862	hsa-miR-4524	CLIP-seq
MIRT1483863	hsa-miR-4533	CLIP-seq
MIRT1483864	hsa-miR-4644	CLIP-seq
MIRT1483865	hsa-miR-4658	CLIP-seq
MIRT1483866	hsa-miR-4667-5p	CLIP-seq
MIRT1483867	hsa-miR-4700-5p	CLIP-seq
MIRT1483868	hsa-miR-4703-5p	CLIP-seq
MIRT1483869	hsa-miR-4728-5p	CLIP-seq
MIRT1483870	hsa-miR-4731-5p	CLIP-seq
MIRT1483871	hsa-miR-4747-5p	CLIP-seq
MIRT1483872	hsa-miR-4766-3p	CLIP-seq
MIRT1483873	hsa-miR-4796-5p	CLIP-seq
MIRT1483874	hsa-miR-494	CLIP-seq
MIRT1483875	hsa-miR-497	CLIP-seq
MIRT1483876	hsa-miR-503	CLIP-seq
MIRT1483877	hsa-miR-516a-3p	CLIP-seq
MIRT1483878	hsa-miR-519d	CLIP-seq
MIRT1483879	hsa-miR-520a-3p	CLIP-seq
MIRT1483880	hsa-miR-520b	CLIP-seq
MIRT1483881	hsa-miR-520c-3p	CLIP-seq
MIRT1483882	hsa-miR-520d-3p	CLIP-seq
MIRT1483883	hsa-miR-520e	CLIP-seq
MIRT1483884	hsa-miR-520g	CLIP-seq
MIRT1483885	hsa-miR-542-5p	CLIP-seq
MIRT1483886	hsa-miR-548a-3p	CLIP-seq
MIRT1483887	hsa-miR-548e	CLIP-seq
MIRT1483888	hsa-miR-548f	CLIP-seq
MIRT1483889	hsa-miR-548p	CLIP-seq
MIRT1483890	hsa-miR-574-5p	CLIP-seq
MIRT1483891	hsa-miR-613	CLIP-seq
MIRT1483814	hsa-miR-637	CLIP-seq
MIRT1483892	hsa-miR-638	CLIP-seq
MIRT1483893	hsa-miR-711	CLIP-seq
MIRT1483894	hsa-miR-93	CLIP-seq
MIRT1483895	hsa-miR-939	CLIP-seq
MIRT2145610	hsa-miR-1236	CLIP-seq
MIRT2145611	hsa-miR-1285	CLIP-seq
MIRT2145612	hsa-miR-134	CLIP-seq
MIRT1483795	hsa-miR-1343	CLIP-seq
MIRT2145613	hsa-miR-139-5p	CLIP-seq
MIRT2145614	hsa-miR-146b-3p	CLIP-seq
MIRT1483826	hsa-miR-185	CLIP-seq
MIRT2145615	hsa-miR-300	CLIP-seq
MIRT2145616	hsa-miR-3118	CLIP-seq
MIRT2145617	hsa-miR-3173-5p	CLIP-seq
MIRT1483839	hsa-miR-3175	CLIP-seq
MIRT2145618	hsa-miR-3187-5p	CLIP-seq
MIRT1483800	hsa-miR-3545-5p	CLIP-seq
MIRT2145619	hsa-miR-3618	CLIP-seq
MIRT2145620	hsa-miR-3650	CLIP-seq
MIRT1483844	hsa-miR-3671	CLIP-seq
MIRT2145621	hsa-miR-3686	CLIP-seq
MIRT2145622	hsa-miR-381	CLIP-seq
MIRT2145623	hsa-miR-3974	CLIP-seq
MIRT1483851	hsa-miR-3978	CLIP-seq
MIRT1483853	hsa-miR-4261	CLIP-seq
MIRT1483854	hsa-miR-4270	CLIP-seq
MIRT1483855	hsa-miR-4274	CLIP-seq
MIRT1483858	hsa-miR-4306	CLIP-seq
MIRT1483860	hsa-miR-4441	CLIP-seq
MIRT2145624	hsa-miR-4455	CLIP-seq
MIRT2145625	hsa-miR-4467	CLIP-seq
MIRT2145626	hsa-miR-4476	CLIP-seq
MIRT2145627	hsa-miR-4491	CLIP-seq
MIRT2145628	hsa-miR-4534	CLIP-seq
MIRT1483864	hsa-miR-4644	CLIP-seq
MIRT1483810	hsa-miR-4652-3p	CLIP-seq
MIRT2145629	hsa-miR-4657	CLIP-seq
MIRT2145630	hsa-miR-4666-3p	CLIP-seq
MIRT2145631	hsa-miR-4700-3p	CLIP-seq
MIRT2145632	hsa-miR-4711-3p	CLIP-seq
MIRT2145633	hsa-miR-4742-3p	CLIP-seq
MIRT2145634	hsa-miR-4751	CLIP-seq
MIRT2145635	hsa-miR-4753-3p	CLIP-seq
MIRT2145636	hsa-miR-4768-5p	CLIP-seq
MIRT2145637	hsa-miR-4772-5p	CLIP-seq
MIRT2145638	hsa-miR-4802-5p	CLIP-seq
MIRT2145639	hsa-miR-493	CLIP-seq
MIRT1483874	hsa-miR-494	CLIP-seq
MIRT2145640	hsa-miR-543	CLIP-seq
MIRT2145641	hsa-miR-548ac	CLIP-seq
MIRT2145642	hsa-miR-548d-3p	CLIP-seq
MIRT1483889	hsa-miR-548p	CLIP-seq
MIRT2145643	hsa-miR-548z	CLIP-seq
MIRT2145644	hsa-miR-609	CLIP-seq
MIRT2145645	hsa-miR-612	CLIP-seq
MIRT2145646	hsa-miR-765	CLIP-seq
MIRT2145647	hsa-miR-874	CLIP-seq
MIRT2145648	hsa-miR-934	CLIP-seq
MIRT1483895	hsa-miR-939	CLIP-seq
MIRT2145649	hsa-miR-943	CLIP-seq
MIRT1483798	hsa-miR-2467-5p	CLIP-seq
MIRT2145620	hsa-miR-3650	CLIP-seq
MIRT1483816	hsa-miR-1	CLIP-seq
MIRT2145610	hsa-miR-1236	CLIP-seq
MIRT1483795	hsa-miR-1343	CLIP-seq
MIRT1483826	hsa-miR-185	CLIP-seq
MIRT1483796	hsa-miR-1976	CLIP-seq
MIRT2366097	hsa-miR-205	CLIP-seq
MIRT2145615	hsa-miR-300	CLIP-seq
MIRT1483836	hsa-miR-3150a-3p	CLIP-seq
MIRT1483839	hsa-miR-3175	CLIP-seq
MIRT1483800	hsa-miR-3545-5p	CLIP-seq
MIRT2145622	hsa-miR-381	CLIP-seq
MIRT1483849	hsa-miR-3908	CLIP-seq
MIRT1483851	hsa-miR-3978	CLIP-seq
MIRT1483853	hsa-miR-4261	CLIP-seq
MIRT1483854	hsa-miR-4270	CLIP-seq
MIRT1483803	hsa-miR-4279	CLIP-seq
MIRT1483858	hsa-miR-4306	CLIP-seq
MIRT1483860	hsa-miR-4441	CLIP-seq
MIRT2145627	hsa-miR-4491	CLIP-seq
MIRT1483864	hsa-miR-4644	CLIP-seq
MIRT2145629	hsa-miR-4657	CLIP-seq
MIRT2145630	hsa-miR-4666-3p	CLIP-seq
MIRT1483866	hsa-miR-4667-5p	CLIP-seq
MIRT1483867	hsa-miR-4700-5p	CLIP-seq
MIRT2145632	hsa-miR-4711-3p	CLIP-seq
MIRT1483870	hsa-miR-4731-5p	CLIP-seq
MIRT2145635	hsa-miR-4753-3p	CLIP-seq
MIRT2145636	hsa-miR-4768-5p	CLIP-seq
MIRT2145637	hsa-miR-4772-5p	CLIP-seq
MIRT1483874	hsa-miR-494	CLIP-seq
MIRT2145640	hsa-miR-543	CLIP-seq
MIRT2145641	hsa-miR-548ac	CLIP-seq
MIRT2145642	hsa-miR-548d-3p	CLIP-seq
MIRT2145643	hsa-miR-548z	CLIP-seq
MIRT2366098	hsa-miR-579	CLIP-seq
MIRT1483891	hsa-miR-613	CLIP-seq
MIRT1483814	hsa-miR-637	CLIP-seq
MIRT1483895	hsa-miR-939	CLIP-seq
MIRT2396814	hsa-miR-1208	CLIP-seq
MIRT1483826	hsa-miR-185	CLIP-seq
MIRT2396815	hsa-miR-2053	CLIP-seq
MIRT2396816	hsa-miR-3143	CLIP-seq
MIRT1483851	hsa-miR-3978	CLIP-seq
MIRT1483853	hsa-miR-4261	CLIP-seq
MIRT1483854	hsa-miR-4270	CLIP-seq
MIRT1483858	hsa-miR-4306	CLIP-seq
MIRT1483860	hsa-miR-4441	CLIP-seq
MIRT1483864	hsa-miR-4644	CLIP-seq
MIRT2145637	hsa-miR-4772-5p	CLIP-seq
MIRT2396817	hsa-miR-4775	CLIP-seq
MIRT1483874	hsa-miR-494	CLIP-seq
MIRT2145640	hsa-miR-543	CLIP-seq
MIRT2396818	hsa-miR-569	CLIP-seq
MIRT2145636	hsa-miR-4768-5p	CLIP-seq
MIRT2145636	hsa-miR-4768-5p	CLIP-seq
MIRT1483816	hsa-miR-1	CLIP-seq
MIRT1483817	hsa-miR-106a	CLIP-seq
MIRT1483818	hsa-miR-106b	CLIP-seq
MIRT2145610	hsa-miR-1236	CLIP-seq
MIRT1483819	hsa-miR-1249	CLIP-seq
MIRT2441633	hsa-miR-1292	CLIP-seq
MIRT2441634	hsa-miR-1299	CLIP-seq
MIRT1483795	hsa-miR-1343	CLIP-seq
MIRT1483820	hsa-miR-1470	CLIP-seq
MIRT2441635	hsa-miR-150	CLIP-seq
MIRT1483824	hsa-miR-17	CLIP-seq
MIRT1483825	hsa-miR-1825	CLIP-seq
MIRT1483826	hsa-miR-185	CLIP-seq
MIRT1483796	hsa-miR-1976	CLIP-seq
MIRT2366097	hsa-miR-205	CLIP-seq
MIRT1483828	hsa-miR-20a	CLIP-seq
MIRT1483829	hsa-miR-20b	CLIP-seq
MIRT1483830	hsa-miR-2115	CLIP-seq
MIRT1483831	hsa-miR-302a	CLIP-seq
MIRT1483832	hsa-miR-302b	CLIP-seq
MIRT1483833	hsa-miR-302c	CLIP-seq
MIRT1483834	hsa-miR-302d	CLIP-seq
MIRT1483835	hsa-miR-302e	CLIP-seq
MIRT2396816	hsa-miR-3143	CLIP-seq
MIRT1483840	hsa-miR-3194-3p	CLIP-seq
MIRT2441636	hsa-miR-3200-5p	CLIP-seq
MIRT2441637	hsa-miR-339-5p	CLIP-seq
MIRT1483800	hsa-miR-3545-5p	CLIP-seq
MIRT1483844	hsa-miR-3671	CLIP-seq
MIRT1483845	hsa-miR-3687	CLIP-seq
MIRT1483846	hsa-miR-372	CLIP-seq
MIRT1483847	hsa-miR-373	CLIP-seq
MIRT1483848	hsa-miR-377	CLIP-seq
MIRT1483851	hsa-miR-3978	CLIP-seq
MIRT1483853	hsa-miR-4261	CLIP-seq
MIRT1483854	hsa-miR-4270	CLIP-seq
MIRT1483855	hsa-miR-4274	CLIP-seq
MIRT1483803	hsa-miR-4279	CLIP-seq
MIRT1483856	hsa-miR-4290	CLIP-seq
MIRT1483857	hsa-miR-4294	CLIP-seq
MIRT1483858	hsa-miR-4306	CLIP-seq
MIRT1483860	hsa-miR-4441	CLIP-seq
MIRT1483861	hsa-miR-4442	CLIP-seq
MIRT1483806	hsa-miR-4460	CLIP-seq
MIRT2441638	hsa-miR-4471	CLIP-seq
MIRT2441639	hsa-miR-4477b	CLIP-seq
MIRT2441640	hsa-miR-4481	CLIP-seq
MIRT1483864	hsa-miR-4644	CLIP-seq
MIRT2441641	hsa-miR-4682	CLIP-seq
MIRT1483870	hsa-miR-4731-5p	CLIP-seq
MIRT2441642	hsa-miR-4745-5p	CLIP-seq
MIRT2441643	hsa-miR-4758-5p	CLIP-seq
MIRT2145637	hsa-miR-4772-5p	CLIP-seq
MIRT2441644	hsa-miR-4782-5p	CLIP-seq
MIRT1483874	hsa-miR-494	CLIP-seq
MIRT1483877	hsa-miR-516a-3p	CLIP-seq
MIRT2441645	hsa-miR-516b	CLIP-seq
MIRT1483878	hsa-miR-519d	CLIP-seq
MIRT1483879	hsa-miR-520a-3p	CLIP-seq
MIRT1483880	hsa-miR-520b	CLIP-seq
MIRT1483881	hsa-miR-520c-3p	CLIP-seq
MIRT1483882	hsa-miR-520d-3p	CLIP-seq
MIRT1483883	hsa-miR-520e	CLIP-seq
MIRT1483884	hsa-miR-520g	CLIP-seq
MIRT2145640	hsa-miR-543	CLIP-seq
MIRT2366098	hsa-miR-579	CLIP-seq
MIRT2441646	hsa-miR-607	CLIP-seq
MIRT1483891	hsa-miR-613	CLIP-seq
MIRT1483814	hsa-miR-637	CLIP-seq
MIRT2441647	hsa-miR-670	CLIP-seq
MIRT1483893	hsa-miR-711	CLIP-seq
MIRT1483894	hsa-miR-93	CLIP-seq
MIRT1483816	hsa-miR-1	CLIP-seq
MIRT2659662	hsa-miR-1224-5p	CLIP-seq
MIRT2659663	hsa-miR-1255a	CLIP-seq
MIRT2659664	hsa-miR-1255b	CLIP-seq
MIRT2659665	hsa-miR-1294	CLIP-seq
MIRT1483795	hsa-miR-1343	CLIP-seq
MIRT1483826	hsa-miR-185	CLIP-seq
MIRT2659666	hsa-miR-1915	CLIP-seq
MIRT1483796	hsa-miR-1976	CLIP-seq
MIRT2659667	hsa-miR-203	CLIP-seq
MIRT2145615	hsa-miR-300	CLIP-seq
MIRT2659668	hsa-miR-3121-3p	CLIP-seq
MIRT2659669	hsa-miR-3130-3p	CLIP-seq
MIRT1483836	hsa-miR-3150a-3p	CLIP-seq
MIRT1483838	hsa-miR-3160-3p	CLIP-seq
MIRT1483839	hsa-miR-3175	CLIP-seq
MIRT2659670	hsa-miR-3179	CLIP-seq
MIRT1483841	hsa-miR-3202	CLIP-seq
MIRT1483800	hsa-miR-3545-5p	CLIP-seq
MIRT2659671	hsa-miR-3605-5p	CLIP-seq
MIRT1483842	hsa-miR-3616-3p	CLIP-seq
MIRT2145620	hsa-miR-3650	CLIP-seq
MIRT1483843	hsa-miR-3659	CLIP-seq
MIRT1483848	hsa-miR-377	CLIP-seq
MIRT2145622	hsa-miR-381	CLIP-seq
MIRT2659672	hsa-miR-3929	CLIP-seq
MIRT1483851	hsa-miR-3978	CLIP-seq
MIRT1483853	hsa-miR-4261	CLIP-seq
MIRT1483854	hsa-miR-4270	CLIP-seq
MIRT1483858	hsa-miR-4306	CLIP-seq
MIRT2659673	hsa-miR-4419b	CLIP-seq
MIRT1483859	hsa-miR-4436b-3p	CLIP-seq
MIRT1483860	hsa-miR-4441	CLIP-seq
MIRT1483806	hsa-miR-4460	CLIP-seq
MIRT2145626	hsa-miR-4476	CLIP-seq
MIRT2659674	hsa-miR-4478	CLIP-seq
MIRT1483864	hsa-miR-4644	CLIP-seq
MIRT2659675	hsa-miR-4649-5p	CLIP-seq
MIRT1483865	hsa-miR-4658	CLIP-seq
MIRT2145630	hsa-miR-4666-3p	CLIP-seq
MIRT1483866	hsa-miR-4667-5p	CLIP-seq
MIRT1483867	hsa-miR-4700-5p	CLIP-seq
MIRT2659676	hsa-miR-4721	CLIP-seq
MIRT2659677	hsa-miR-4726-3p	CLIP-seq
MIRT1483869	hsa-miR-4728-5p	CLIP-seq
MIRT1483870	hsa-miR-4731-5p	CLIP-seq
MIRT2145634	hsa-miR-4751	CLIP-seq
MIRT2145637	hsa-miR-4772-5p	CLIP-seq
MIRT1483874	hsa-miR-494	CLIP-seq
MIRT1483885	hsa-miR-542-5p	CLIP-seq
MIRT2145641	hsa-miR-548ac	CLIP-seq
MIRT2145642	hsa-miR-548d-3p	CLIP-seq
MIRT1483889	hsa-miR-548p	CLIP-seq
MIRT2145643	hsa-miR-548z	CLIP-seq
MIRT1483890	hsa-miR-574-5p	CLIP-seq
MIRT2441646	hsa-miR-607	CLIP-seq
MIRT1483891	hsa-miR-613	CLIP-seq
MIRT1483814	hsa-miR-637	CLIP-seq
MIRT1483892	hsa-miR-638	CLIP-seq
MIRT1483895	hsa-miR-939	CLIP-seq
MIRT1483816	hsa-miR-1	CLIP-seq
MIRT2659662	hsa-miR-1224-5p	CLIP-seq
MIRT2659663	hsa-miR-1255a	CLIP-seq
MIRT2659664	hsa-miR-1255b	CLIP-seq
MIRT2659665	hsa-miR-1294	CLIP-seq
MIRT1483795	hsa-miR-1343	CLIP-seq
MIRT1483826	hsa-miR-185	CLIP-seq
MIRT1483796	hsa-miR-1976	CLIP-seq
MIRT2659667	hsa-miR-203	CLIP-seq
MIRT2145615	hsa-miR-300	CLIP-seq
MIRT2659668	hsa-miR-3121-3p	CLIP-seq
MIRT2659669	hsa-miR-3130-3p	CLIP-seq
MIRT1483836	hsa-miR-3150a-3p	CLIP-seq
MIRT1483839	hsa-miR-3175	CLIP-seq
MIRT2659670	hsa-miR-3179	CLIP-seq
MIRT1483841	hsa-miR-3202	CLIP-seq
MIRT1483800	hsa-miR-3545-5p	CLIP-seq
MIRT2659671	hsa-miR-3605-5p	CLIP-seq
MIRT1483842	hsa-miR-3616-3p	CLIP-seq
MIRT2145620	hsa-miR-3650	CLIP-seq
MIRT1483848	hsa-miR-377	CLIP-seq
MIRT2145622	hsa-miR-381	CLIP-seq
MIRT2659672	hsa-miR-3929	CLIP-seq
MIRT1483851	hsa-miR-3978	CLIP-seq
MIRT1483853	hsa-miR-4261	CLIP-seq
MIRT1483854	hsa-miR-4270	CLIP-seq
MIRT1483858	hsa-miR-4306	CLIP-seq
MIRT2659673	hsa-miR-4419b	CLIP-seq
MIRT1483860	hsa-miR-4441	CLIP-seq
MIRT1483806	hsa-miR-4460	CLIP-seq
MIRT2145626	hsa-miR-4476	CLIP-seq
MIRT2659674	hsa-miR-4478	CLIP-seq
MIRT1483864	hsa-miR-4644	CLIP-seq
MIRT2145630	hsa-miR-4666-3p	CLIP-seq
MIRT1483866	hsa-miR-4667-5p	CLIP-seq
MIRT1483867	hsa-miR-4700-5p	CLIP-seq
MIRT1483870	hsa-miR-4731-5p	CLIP-seq
MIRT2145634	hsa-miR-4751	CLIP-seq
MIRT2145637	hsa-miR-4772-5p	CLIP-seq
MIRT1483874	hsa-miR-494	CLIP-seq
MIRT1483885	hsa-miR-542-5p	CLIP-seq
MIRT2145641	hsa-miR-548ac	CLIP-seq
MIRT2145642	hsa-miR-548d-3p	CLIP-seq
MIRT1483889	hsa-miR-548p	CLIP-seq
MIRT2145643	hsa-miR-548z	CLIP-seq
MIRT2441646	hsa-miR-607	CLIP-seq
MIRT1483891	hsa-miR-613	CLIP-seq
MIRT1483814	hsa-miR-637	CLIP-seq
MIRT1483892	hsa-miR-638	CLIP-seq
MIRT1483895	hsa-miR-939	CLIP-seq

Transcription factors

Show/Hide all(81)

Transcription factor	Regulation	Reference
AR	Activation	16007189
AR	Unknown	23369005
ARNT	Unknown	16774940;19020709
ATF4	Activation	15788408;18829529
ATF4	Unknown	18451308;22915762;23908598
ATM	Repression	20676049
BRCA1	Activation	16543242
COPS5	Activation	12542982
DNMT1	Activation	17934516
E2F1	Repression	20639906
E2F3	Unknown	21372519
EGR1	Activation	20489156
EGR1	Repression	15517885
EGR1	Unknown	9049304
EP300	Activation	22789427
EPAS1	Activation	11301389;11751212;16900513;19080330
EPAS1	Unknown	15156561;16920734
ESR1	Activation	19398483
ESR1	Unknown	10995484;14647449
ESR2	Unknown	10995484
FOXM1	Unknown	21860419
FOXO3	Unknown	21860419
FOXQ1	Activation	20145154
HDAC2	Unknown	23926105
HDAC3	Unknown	23926105
HDAC4	Repression	19509297
HDGF	Activation	14662017;21302807
HEXIM1	Unknown	20453883
HIC1	Repression	24067369
HIF1A	Activation	11749701;12542982;12820439;15315159;15735682;15890092;16052307;16515634;16540671;16854277;16900513;17461470;17557905;17889387;18027712;18060642;18572865;19759417;22789427
HIF1A	Repression	12509854;14712484;15930297;16596228;18471962
HIF1A	Unknown	11486006;15156561;16543242;16774940;17486380;18835464;19238077;19502554;21731766;23060442
HIPK2	Repression	18644116;19046997
HNF1A	Unknown	21731766
HOXB7	Activation	21183939
HTATIP2	Repression	19349353
ID3	Unknown	16926250
JUN	Repression	11731421
KLF4	Unknown	23926105
MEF2C	Unknown	18450586
MYC	Activation	19398483
MYC	Unknown	18809243
NFKB1	Activation	15856023;16684540;17407600;18056465
NFKB1	Repression	15517885
NFKB1	Unknown	12160329;17673602;18184402;20103608;20538607
NKX3-1	Unknown	18974119
NR1H4	Activation	21364590
PGR	Unknown	22542550
PTTG1	Activation	12213878;16926250
RB1	Activation	16007189
RELA	Activation	15856023;16684540;17407600;18056465
RELA	Repression	15517885
RELA	Unknown	12160329;17673602;18184402;20103608;20538607
RUNX1	Repression	21447743
RUNX2	Activation	19509297;22641097
SMAD3	Unknown	11486006
SP1	Activation	10581162;12429844;15217947;15342781;16540671;16982770;21115498
SP1	Repression	11559575
SP1	Unknown	10816575;11731421;12560084;14647449;18575762;23369005;8910439
SP3	Unknown	10816575;14647449
STAT3	Unknown	23104276
STAT3	Activation	11960372;15735682;17169602;17533737;19284568;19880237;21278793;21418908
STAT3	Repression	17533737;19880237;22313388
STAT3	Unknown	12824281;16540670;16899623;17937859;18184402;18320073;19020709;20043094;21172343;21344490;21731766;25101566
TCF4	Activation	15940626
TEAD4	Repression	22761647
TFAP2A	Activation	9049304
TFAP2A	Unknown	11731421
TP53	Activation	16684540
TP53	Repression	11559575
TRAF6	Repression	22326918
UHRF1	Unknown	17934516
VHL	Activation	10804089;7533661;8625303
VHL	Repression	10581162;12539169;12912922;8855222;9370235
VHL	Unknown	10189987;19801654;9572397;9689663
WT1	Activation	20871039
WT1	Unknown	16572586;17127464
XBP1	Unknown	20824063
ZFP36	Repression	21507959;21656745
ZFP36L1	Repression	19801654
ZNF24	Repression	20510677;23212515

Show/Hide all(241)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	18093989
GO:0001525	Process	Angiogenesis	IDA	11427521, 21771332
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001541	Process	Ovarian follicle development	IEA
GO:0001541	Process	Ovarian follicle development	ISS
GO:0001568	Process	Blood vessel development	IEA
GO:0001569	Process	Branching involved in blood vessel morphogenesis	IMP	23688497
GO:0001569	Process	Branching involved in blood vessel morphogenesis	IMP	23083510, 23688497
GO:0001570	Process	Vasculogenesis	TAS	15015550
GO:0001666	Process	Response to hypoxia	IBA
GO:0001666	Process	Response to hypoxia	IDA	16490744
GO:0001701	Process	In utero embryonic development	IEA
GO:0001701	Process	In utero embryonic development	ISS
GO:0001822	Process	Kidney development	IEA
GO:0001822	Process	Kidney development	ISS
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	19033661
GO:0001935	Process	Endothelial cell proliferation	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IDA	12714610
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IDA	9202027, 10022831, 16489009, 18577655, 20497126, 31915155
GO:0001938	Process	Positive regulation of endothelial cell proliferation	ISS
GO:0001944	Process	Vasculature development	IEA
GO:0001946	Process	Lymphangiogenesis	IEA
GO:0001968	Function	Fibronectin binding	IDA	14570917
GO:0002040	Process	Sprouting angiogenesis	IBA
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IDA	20660291
GO:0002052	Process	Positive regulation of neuroblast proliferation	IEA
GO:0002052	Process	Positive regulation of neuroblast proliferation	ISS
GO:0002070	Process	Epithelial cell maturation	IEA
GO:0002092	Process	Positive regulation of receptor internalization	IDA	20660291
GO:0002376	Process	Immune system process	IEA
GO:0002575	Process	Basophil chemotaxis	IDA	17082651
GO:0002687	Process	Positive regulation of leukocyte migration	TAS	1312256
GO:0003007	Process	Heart morphogenesis	IEA
GO:0003007	Process	Heart morphogenesis	ISS
GO:0003151	Process	Outflow tract morphogenesis	ISS
GO:0003169	Process	Coronary vein morphogenesis	ISS
GO:0005125	Function	Cytokine activity	IDA	18440775
GO:0005125	Function	Cytokine activity	ISS
GO:0005161	Function	Platelet-derived growth factor receptor binding	IPI	17470632
GO:0005172	Function	Vascular endothelial growth factor receptor binding	IBA
GO:0005172	Function	Vascular endothelial growth factor receptor binding	IPI	9529250, 10471394, 11513746
GO:0005515	Function	Protein binding	IPI	1312256, 1417831, 9393862, 10543948, 16763549, 17222790, 17446437, 20145116, 20660291, 21596751, 21653826, 22020326, 22897854, 23374253, 23583373, 25825981, 32296183, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	9202027, 16490744
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	17082651
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005912	Component	Adherens junction	IDA	26598555
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IMP	18093989
GO:0006915	Process	Apoptotic process	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	18059339
GO:0007399	Process	Nervous system development	TAS	15351965
GO:0007405	Process	Neuroblast proliferation	IEA
GO:0007498	Process	Mesoderm development	IEA
GO:0007498	Process	Mesoderm development	ISS
GO:0007595	Process	Lactation	IEA
GO:0007595	Process	Lactation	ISS
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IDA	9202027, 20497126
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	ISS
GO:0008201	Function	Heparin binding	IDA	15001987
GO:0008201	Function	Heparin binding	IEA
GO:0008201	Function	Heparin binding	IMP	14570917
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	7929439
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	26268439
GO:0008360	Process	Regulation of cell shape	IDA	7929439, 10527820
GO:0009986	Component	Cell surface	IDA	17470632
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	10022831, 19033661, 31915155
GO:0010628	Process	Positive regulation of gene expression	IDA	22696064
GO:0010629	Process	Negative regulation of gene expression	IDA	22773844, 28977001
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IMP	19148554
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IEA
GO:0010749	Process	Regulation of nitric oxide mediated signal transduction	IDA	16150726
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0022408	Process	Negative regulation of cell-cell adhesion	IEA
GO:0030141	Component	Secretory granule	IDA	17082651
GO:0030154	Process	Cell differentiation	IEA
GO:0030224	Process	Monocyte differentiation	IDA	21149635
GO:0030225	Process	Macrophage differentiation	IDA	21149635
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IDA	20497126
GO:0030324	Process	Lung development	IEA
GO:0030324	Process	Lung development	ISS
GO:0030335	Process	Positive regulation of cell migration	IDA	7929439, 17470632
GO:0030855	Process	Epithelial cell differentiation	IEA
GO:0030855	Process	Epithelial cell differentiation	ISS
GO:0031012	Component	Extracellular matrix	NAS	14570917
GO:0031077	Process	Post-embryonic camera-type eye development	IEA
GO:0031077	Process	Post-embryonic camera-type eye development	ISS
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0031290	Process	Retinal ganglion cell axon guidance	IEA
GO:0031290	Process	Retinal ganglion cell axon guidance	ISS
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	16489009, 19033661
GO:0031954	Process	Positive regulation of protein autophosphorylation	IDA	17470632
GO:0035148	Process	Tube formation	IDA	19033661
GO:0035767	Process	Endothelial cell chemotaxis	IDA	18440775, 21245381
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IDA	18440775, 20497126
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IEA
GO:0036303	Process	Lymph vessel morphogenesis	ISS
GO:0036324	Process	Vascular endothelial growth factor receptor-2 signaling pathway	IMP	23688497
GO:0038033	Process	Positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway	IDA	31915155
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IBA
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IDA	16774925, 20660291, 23639442, 30496354
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IMP	19148554, 23083510
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	NAS	23878390
GO:0038091	Process	Positive regulation of cell proliferation by VEGF-activated platelet derived growth factor receptor signaling pathway	IDA	17470632
GO:0038190	Process	VEGF-activated neuropilin signaling pathway	IMP	24863063
GO:0038190	Process	VEGF-activated neuropilin signaling pathway	ISS
GO:0038191	Function	Neuropilin binding	IPI	24401374
GO:0040008	Process	Regulation of growth	IEA
GO:0042056	Function	Chemoattractant activity	IBA
GO:0042056	Function	Chemoattractant activity	IDA	17082651, 18059339, 18440775, 19275959, 20497126, 21245381
GO:0042056	Function	Chemoattractant activity	IEA
GO:0042056	Function	Chemoattractant activity	ISS
GO:0042311	Process	Vasodilation	IEA
GO:0042462	Process	Eye photoreceptor cell development	IEA
GO:0042462	Process	Eye photoreceptor cell development	ISS
GO:0042802	Function	Identical protein binding	IPI	1312256, 12207021, 22897854, 25132001
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	10066377, 11461089
GO:0043117	Process	Positive regulation of vascular permeability	IDA	16109918, 26598555
GO:0043117	Process	Positive regulation of vascular permeability	IEA
GO:0043117	Process	Positive regulation of vascular permeability	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	NAS	23878390
GO:0043129	Process	Surfactant homeostasis	IEA
GO:0043129	Process	Surfactant homeostasis	ISS
GO:0043183	Function	Vascular endothelial growth factor receptor 1 binding	IPI	1312256
GO:0043184	Function	Vascular endothelial growth factor receptor 2 binding	IEA
GO:0043184	Function	Vascular endothelial growth factor receptor 2 binding	IPI	1417831, 10022831, 20660291, 25825981
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	18440775, 31915155
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IDA	9202027, 18440775, 20497126
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IMP	23688497
GO:0043542	Process	Endothelial cell migration	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045601	Process	Regulation of endothelial cell differentiation	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IDA	18440775, 18577655, 19033661, 20497126, 22773844
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IMP	18275976
GO:0045785	Process	Positive regulation of cell adhesion	IDA	19674970
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	18059339, 18093989, 20497126
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	18093989, 19652095
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IBA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IDA	1312256, 7929439, 18059339, 18440775, 21245381, 23639442, 31915155
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IMP	20497126
GO:0048018	Function	Receptor ligand activity	IMP	23083510
GO:0048018	Function	Receptor ligand activity	IPI	17470632, 20660291
GO:0048469	Process	Cell maturation	ISS
GO:0048514	Process	Blood vessel morphogenesis	IEA
GO:0048593	Process	Camera-type eye morphogenesis	IEA
GO:0048593	Process	Camera-type eye morphogenesis	ISS
GO:0048842	Process	Positive regulation of axon extension involved in axon guidance	IEA
GO:0048842	Process	Positive regulation of axon extension involved in axon guidance	ISS
GO:0048844	Process	Artery morphogenesis	IEA
GO:0048844	Process	Artery morphogenesis	ISS
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	ISS
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	16489009
GO:0050840	Function	Extracellular matrix binding	IC	14570917
GO:0050918	Process	Positive chemotaxis	IDA	20497126
GO:0050918	Process	Positive chemotaxis	IEA
GO:0050918	Process	Positive chemotaxis	ISS
GO:0050927	Process	Positive regulation of positive chemotaxis	IDA	7929439, 12744932
GO:0050930	Process	Induction of positive chemotaxis	IBA
GO:0050930	Process	Induction of positive chemotaxis	IDA	19275959
GO:0050930	Process	Induction of positive chemotaxis	NAS	12744932
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051894	Process	Positive regulation of focal adhesion assembly	IDA	16489009
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	30496354, 31915155
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IGI	30496354, 31915155
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	24863063
GO:0055013	Process	Cardiac muscle cell development	IEA
GO:0055013	Process	Cardiac muscle cell development	ISS
GO:0060319	Process	Primitive erythrocyte differentiation	IEA
GO:0060319	Process	Primitive erythrocyte differentiation	ISS
GO:0060346	Process	Bone trabecula formation	IEA
GO:0060426	Process	Lung vasculature development	IEA
GO:0060749	Process	Mammary gland alveolus development	IEA
GO:0060749	Process	Mammary gland alveolus development	ISS
GO:0060754	Process	Positive regulation of mast cell chemotaxis	IBA
GO:0060754	Process	Positive regulation of mast cell chemotaxis	IDA	19275959
GO:0060948	Process	Cardiac vascular smooth muscle cell development	ISS
GO:0060982	Process	Coronary artery morphogenesis	ISS
GO:0061042	Process	Vascular wound healing	IMP	23688497
GO:0061430	Process	Bone trabecula morphogenesis	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	23639442
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	24863063
GO:0071456	Process	Cellular response to hypoxia	IDA	10575000
GO:0071456	Process	Cellular response to hypoxia	IMP	19652095
GO:0071542	Process	Dopaminergic neuron differentiation	IEA
GO:0071542	Process	Dopaminergic neuron differentiation	ISS
GO:0071679	Process	Commissural neuron axon guidance	IEA
GO:0071679	Process	Commissural neuron axon guidance	ISS
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IDA	18059339, 20551324
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IGI	24844779
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IMP	23083510, 24865854
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	IEA
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	ISS
GO:0097475	Process	Motor neuron migration	IEA
GO:0097475	Process	Motor neuron migration	ISS
GO:0097533	Process	Cellular stress response to acid chemical	IDA	26299712
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	26683794
GO:1900748	Process	Positive regulation of vascular endothelial growth factor signaling pathway	IDA	23688497
GO:1901165	Process	Positive regulation of trophoblast cell migration	IMP	23083510
GO:1901492	Process	Positive regulation of lymphangiogenesis	IEA
GO:1901532	Process	Regulation of hematopoietic progenitor cell differentiation	IEA
GO:1902894	Process	Negative regulation of miRNA transcription	NAS	23878390
GO:1902966	Process	Positive regulation of protein localization to early endosome	IDA	23639442
GO:1903141	Process	Negative regulation of establishment of endothelial barrier	IDA	20048167
GO:1903392	Process	Negative regulation of adherens junction organization	IDA	26598555
GO:1903589	Process	Positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IGI	24844779
GO:1903589	Process	Positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IMP	30106099
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IDA	26299712
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IGI	25251394
GO:1905278	Process	Positive regulation of epithelial tube formation	IDA	31915155
GO:1905555	Process	Positive regulation of blood vessel branching	IDA	20123964
GO:1905604	Process	Negative regulation of blood-brain barrier permeability	IMP	19148554
GO:1990150	Component	VEGF-A complex	IPI	12207021
GO:2000048	Process	Negative regulation of cell-cell adhesion mediated by cadherin	IDA	26598555
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IDA	16774925
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IGI	16774925
GO:2001028	Process	Positive regulation of endothelial cell chemotaxis	IDA	20497126

MIM	HGNC	e!Ensembl
192240	12680	ENSG00000112715

Protein

UniProt ID

P15692

Protein name

Vascular endothelial growth factor A, long form (L-VEGF) (Vascular permeability factor) (VPF) [Cleaved into: N-VEGF; VEGFA]

Protein function

[N-VEGF]: Participates in the induction of key genes involved in the response to hypoxia and in the induction of angiogenesis such as HIF1A (PubMed:35455969). Involved in protecting cells from hypoxia-mediated cell death (By similarity). {ECO:00

PDB

1BJ1 , 1CZ8 , 1FLT , 1KAT , 1KMX , 1MJV , 1MKG , 1MKK , 1QTY , 1TZH , 1TZI , 1VGH , 1VPF , 1VPP , 2FJG , 2FJH , 2QR0 , 2VGH , 2VPF , 3BDY , 3P9W , 3QTK , 3S1B , 3S1K , 3V2A , 4DEQ , 4GLN , 4GLS , 4KZN , 4QAF , 4WPB , 4ZFF , 5DN2 , 5FV1 , 5FV2 , 5HHC , 5HHD , 5O4E , 5T89 , 6BFT , 6D3O , 6T9D , 6V7K , 6Z13 , 6Z3F , 6ZBR , 6ZCD , 6ZFL , 7KEZ , 7KF0 , 7KF1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00341	PDGF	52 → 130	PDGF/VEGF domain	Domain
PF14554	VEGF_C	180 → 232	VEGF heparin-binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Higher expression in pituitary tumors than the pituitary gland. {ECO:0000269|PubMed:22009797}.; TISSUE SPECIFICITY: [Isoform VEGF189]: Widely expressed.; TISSUE SPECIFICITY: [Isoform VEGF165]: Widely expressed.; TISSUE SPECIFICITY: [Is

Sequence

MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM
SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPG
PHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Sequence length

232

Interactions

View interactions

	KEGG		Reactome
	EGFR tyrosine kinase inhibitor resistance MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway Calcium signaling pathway HIF-1 signaling pathway PI3K-Akt signaling pathway VEGF signaling pathway Focal adhesion Relaxin signaling pathway AGE-RAGE signaling pathway in diabetic complications Human cytomegalovirus infection Human papillomavirus infection Kaposi sarcoma-associated herpesvirus infection Pathways in cancer Proteoglycans in cancer MicroRNAs in cancer Chemical carcinogenesis - receptor activation Chemical carcinogenesis - reactive oxygen species Renal cell carcinoma Pancreatic cancer Bladder cancer Rheumatoid arthritis Fluid shear stress and atherosclerosis		Platelet degranulation Regulation of gene expression by Hypoxia-inducible Factor Signaling by VEGF VEGF ligand-receptor interactions VEGF binds to VEGFR leading to receptor dimerization VEGFA-VEGFR2 Pathway VEGFR2 mediated cell proliferation Interleukin-4 and Interleukin-13 signaling TFAP2 (AP-2) family regulates transcription of growth factors and their receptors

Show/Hide Unknown Diseases (17)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer's disease or family history of Alzheimer's disease	N/A	N/A	GWAS
Atherosclerosis	Atherosclerosis, susceptibility to	N/A	N/A	ClinVar
Atrial Fibrillation	Atrial fibrillation	N/A	N/A	GWAS
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Coronary Heart Disease	Coronary heart disease	N/A	N/A	GWAS
Diabetes	Type 2 diabetes mellitus adjusted for BMI or coronary artery disease (pleiotropy), Type 2 diabetes, Type 2 diabetes mellitus or coronary artery disease (pleiotropy)	N/A	N/A	GWAS
Gout	Gout	N/A	N/A	GWAS
Hypertension	Hypertension (confirmatory factor analysis Factor 12)	N/A	N/A	GWAS
Hyperuricemia	Hyperuricemia	N/A	N/A	GWAS
Hypothyroidism	Hypothyroidism	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS
Kidney Disease	Chronic kidney disease	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Myocardial Infarction	Myocardial infarction	N/A	N/A	GWAS
Osteosarcoma	Osteosarcoma	Our results demonstrated that LC09 facilitated selective distribution of CRISPR/Cas9 in both orthotopic OS and lung metastasis, leading to effective VEGFA genome editing in tumor, decreased VEGFA expression and secretion, inhibited orthotopic OS malignanc	28938163	CBGDA
Prostate cancer	Prostate cancer	N/A	N/A	GWAS
Ulcerative colitis	Ulcerative colitis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (1217)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
3C syndrome	Associate	19041064
Abdominal Injuries	Associate	12853702
Ablepharon macrostomia syndrome	Associate	23553563
Abortion Habitual	Associate	15820807, 21458805, 24260517, 25826496, 30680517, 31906232, 36745296
Abortion Habitual	Inhibit	33390589
Abortion Habitual	Stimulate	36302396
Abortion Spontaneous	Associate	15820807, 21458805, 22867902, 33405003, 38195505
Abortion Spontaneous	Stimulate	24098721, 36096448
Abortion Spontaneous	Inhibit	37968664
Abscess	Stimulate	34539639
Acidemia isovaleric	Associate	20690185
Acquired Immunodeficiency Syndrome	Associate	8644848
Acute Coronary Syndrome	Associate	34260629
Acute Kidney Injury	Associate	17353160, 19295501
Acute Kidney Injury	Inhibit	28183278
Acute Lung Injury	Associate	22742663, 22795057
Acute On Chronic Liver Failure	Associate	35502507
Adenocarcinoma	Stimulate	12579092, 16495697, 21498541, 24480048, 26399340, 31564192, 37512001, 9605068
Adenocarcinoma	Associate	12800229, 15113042, 15167937, 16972327, 16984727, 17099695, 17785951, 17965528, 18590539, 18780893, 19055699, 20237991, 22231433, 22258871, 24068399 View all (10 more)
Adenocarcinoma Bronchiolo Alveolar	Associate	15167937
Adenocarcinoma Clear Cell	Associate	25178336
Adenocarcinoma Mucinous	Associate	19448592
Adenocarcinoma of Lung	Associate	11920479, 16153921, 19212102, 19337377, 21333376, 21785272, 23298487, 25816409, 26097560, 26343694, 26360882, 28241836, 33446784, 34236827, 34894606 View all (4 more)
Adenocarcinoma of Lung	Stimulate	37583701
Adenoma	Associate	12632503, 20063187, 35260162, 35810100
Adenoma	Stimulate	24260316
Adenoma Chromophobe	Stimulate	34870494
Adenoma Pleomorphic	Associate	22022178, 26031756, 34884420
Adenomatous Polyposis Coli	Associate	33108070
Adenomyosis	Stimulate	27759451
Adenomyosis	Associate	38195505
Adrenal Gland Neoplasms	Associate	24260316
Airway Obstruction	Associate	19107589, 26488115, 34946296
Allergic Fungal Sinusitis	Associate	19762561, 26047816
Altitude Sickness	Associate	21217075, 23321170, 23553563, 24971768, 32478477, 32718338
Alzheimer Disease	Associate	21931866, 25751166, 29848382, 29851783, 31332262, 32980851, 33186918, 35347084, 36680854, 36905877, 37009506, 37047617, 37385335, 37596325, 38160360, 39385222 View all (1 more)
Alzheimer Disease	Stimulate	23182805
Alzheimer Disease	Inhibit	31791659, 34845413
Ameloblastoma	Associate	33067558
Amyloid Neuropathies Familial	Associate	17522146
Amyloidosis	Associate	17522146
Amyloidosis familial visceral	Associate	17994443
Amyotrophic Lateral Sclerosis	Inhibit	16421133
Amyotrophic Lateral Sclerosis	Associate	17456229, 19196430, 26210997, 29702606, 40097075
Amyotrophic Lateral Sclerosis	Stimulate	21906274, 32586411
Anemia	Associate	16827797, 35090332
Anemia Aplastic	Inhibit	16400015, 19154660
Anemia Aplastic	Associate	20348277
Anemia Aplastic	Stimulate	20443870
Anemia Refractory with Excess of Blasts	Associate	11222390
Anemia Sickle Cell	Stimulate	10339489, 12111782
Anemia Sickle Cell	Associate	28832635, 32352161, 32411797
Aneuploidy	Associate	15274325
Aneurysm	Associate	23746831
Angina Pectoris	Inhibit	15347709
Angina Unstable	Stimulate	23421785
Angiofibroma	Stimulate	29634432
Angiomatosis Bacillary	Associate	10888784
Aniridia	Associate	40570009
Anodontia	Stimulate	28578351
Anterior Cruciate Ligament Injuries	Stimulate	39354436
Anterior Wall Myocardial Infarction	Associate	26930482
Anti N Methyl D Aspartate Receptor Encephalitis	Associate	32771066
Antiphospholipid Syndrome	Stimulate	16968331
Anxiety Disorders	Associate	31776047
Aortic Aneurysm Abdominal	Associate	24657063
Aortic Aneurysm Abdominal	Stimulate	27720318
Aortic Aneurysm Thoracic	Stimulate	35563123
Aortic Diseases	Associate	35922433
Aortic Valve Insufficiency	Associate	14760594
Aortic Valve Stenosis	Associate	18718425
Aphasia	Associate	36820574
Appendiceal Neoplasms	Associate	19448592
Arterial Occlusive Diseases	Inhibit	32022379
Arteriovenous Fistula	Associate	36642504
Arteriovenous Malformations	Associate	25839219
Arthralgia	Associate	30420902
Arthritis	Associate	11592363, 28765881, 30420902, 33958655, 34918882
Arthritis Infectious	Inhibit	12653578
Arthritis Juvenile	Stimulate	38166934
Arthritis Psoriatic	Associate	16741508, 17204151, 22283733, 23303013, 27706699, 30181004
Arthritis Psoriatic	Inhibit	17204151
Arthritis Psoriatic	Stimulate	24146263, 31864394, 37979213, 7615975, 8064230, 9049304
Arthritis Rheumatoid	Associate	10337031, 10971521, 11710707, 12384916, 12847684, 16519794, 17530707, 18721452, 19176759, 19883500, 21179282, 22866899, 23684916, 24309559, 25894998 View all (17 more)
Arthritis Rheumatoid	Stimulate	12823854, 27513931, 32840301, 35653890, 38081836, 7531945, 8006592
Arthropathy progressive pseudorheumatoid of childhood	Associate	25027022
Ascites	Associate	10804091, 14606105, 19589268, 23169339, 26143638, 26158818, 26868378, 27258020, 30843637, 8006592
Ascites	Stimulate	18075302
Ascites	Inhibit	28183278
Asthma	Associate	14633511, 15665043, 19196819, 22461367, 22689881, 27173321, 27336865, 27579513, 28056993, 30574871, 30740942, 31524265, 31586488, 32526308, 33626956 View all (5 more)
Asthma	Stimulate	23845883
Asthma Chronic Obstructive Pulmonary Disease Overlap Syndrome	Associate	32103934
Astrocytoma	Stimulate	12356354, 20052595, 28281545
Astrocytoma	Associate	12937144, 15973775, 16900782, 23338113, 8835763
Ataxia Telangiectasia	Associate	26189429, 26820153
Atelosteogenesis type 1	Associate	24353325
Atherosclerosis	Associate	10731922, 14990597, 15937083, 16085213, 18270456, 19148342, 19176759, 21757650, 26959822, 27704620, 30041762, 33942489, 35052452, 35365727, 37880698, 39201353, 7843420, 9137092 View all (3 more)
Atrial Fibrillation	Stimulate	20631454
Atrioventricular Septal Defect	Associate	23040494
Atrophy	Associate	25751166, 28231837, 34721402, 37861555
Atypical Squamous Cells of the Cervix	Associate	22990551, 30043637
Autoimmune Diseases	Associate	11110694, 26955881
Autoimmune Diseases	Inhibit	17696908
Axial Spondyloarthritis	Associate	33317138
Azoospermia	Associate	19107589, 40215689
Barrett Esophagus	Associate	12579092, 31363321
Behcet Syndrome	Associate	29854829, 30420902, 34918882
beta Thalassemia	Associate	29061162
Bicuspid Aortic Valve Disease	Associate	21481422
Bietti Crystalline Dystrophy	Associate	32799831
Biliary Atresia	Associate	29251369
Biliary Tract Neoplasms	Associate	23057767, 26179201
Birt Hogg Dube Syndrome	Stimulate	21057536
Birth Weight	Associate	17353160
Bisphosphonate Associated Osteonecrosis of the Jaw	Associate	21251073, 22864527
Blast Crisis	Associate	18534064
Blindness	Associate	22457763
Blister	Associate	7738351
Blood Coagulation Disorders	Associate	30781507
Blood Loss Surgical	Associate	35585570
Blood Platelet Disorders	Associate	15613012
Blood Platelet Disorders	Stimulate	32234826
Bloom Syndrome	Associate	20685877
Bone Diseases	Associate	25894998, 29149180, 36147560, 36967561
Bone Diseases Metabolic	Associate	29518117
Bone Marrow Diseases	Stimulate	24890946, 31042345, 32383346
Bone Marrow Neoplasms	Associate	19154660
Bone Neoplasms	Associate	25644713
Bone Resorption	Associate	25278075
Brain Diseases	Associate	18854444, 26908328, 36426373
Brain Edema	Associate	21968684, 22420586, 25821815, 34815366
Brain Injuries	Associate	37047617
Brain Injuries Traumatic	Associate	24067772, 37047617
Brain Injury Chronic	Stimulate	19917374
Brain Ischemia	Stimulate	11029398, 11279416, 24251624, 31715125
Brain Ischemia	Associate	11029398, 14981457, 15770733, 17698375, 27951596, 30539420
Brain Ischemia	Inhibit	15347709
Brain Neoplasms	Stimulate	28691414
Brain Neoplasms	Associate	28948065, 29110584, 30451357, 31527824, 36435833, 8910439
Breast Diseases	Associate	29955134
Breast Neoplasms	Associate	10360672, 10496346, 10551327, 10574263, 11336478, 11556826, 12087467, 12105188, 12115372, 12918061, 14660675, 14680499, 14738568, 15274325, 15297858 View all (162 more)
Breast Neoplasms	Stimulate	15113858, 18715621, 22982376, 23534767, 23750285, 23981902, 26456994, 32108136
Breast Neoplasms Male	Associate	19664288
Brenner Tumor	Associate	9032563
Bronchiolitis Obliterans Syndrome	Associate	15760400, 32250877
Bronchiolitis Obliterans Syndrome	Stimulate	20654580
Bronchitis	Stimulate	21306579
Bronchopulmonary Dysplasia	Associate	18420967, 20826912, 24662923, 36092960, 37272765
Calcinosis Cutis	Associate	10735511, 11487257, 16528367, 17595666, 20665500, 33751828, 35269689, 36656585
Calculi	Associate	23057767
Capillary Malformation Arteriovenous Malformation	Associate	35722791
Carcinogenesis	Associate	11141500, 12070140, 12213806, 14669355, 18806258, 19300368, 20205278, 20712888, 21119072, 21224502, 21424698, 22205725, 22558473, 25523098, 27982164 View all (18 more)
Carcinogenesis	Inhibit	15517881
Carcinogenesis	Stimulate	26325091
Carcinoid Tumor	Stimulate	23339006
Carcinoid Tumor	Associate	9683299
Carcinoma	Associate	37185612
Carcinoma Acinar Cell	Associate	23771070
Carcinoma Adenoid Cystic	Associate	17543095, 19317804, 26194375, 30945361, 36281584
Carcinoma Adenoid Cystic	Stimulate	20690417, 28961428
Carcinoma Basal Cell	Stimulate	11092527
Carcinoma Basal Cell	Associate	22895562, 24902660, 25181405, 25261667
Carcinoma Ductal	Associate	18758633, 22894137, 27903846, 40042161
Carcinoma Ductal Breast	Associate	21606203, 22174163, 24022309, 37975220
Carcinoma Endometrioid	Stimulate	22944067
Carcinoma Endometrioid	Associate	34256796
Carcinoma Hepatocellular	Associate	10636104, 10741909, 10888784, 11115828, 11176129, 14991930, 14991937, 15040022, 15133868, 15460907, 15633213, 15742396, 15786555, 15800977, 15991282 View all (84 more)
Carcinoma Hepatocellular	Stimulate	15334691, 15655835, 18193117, 18300343, 18701503, 23091809, 23485556, 36853298
Carcinoma Hepatocellular	Inhibit	31450899
Carcinoma in Situ	Associate	16613616
Carcinoma Intraductal Noninfiltrating	Associate	18384688
Carcinoma Large Cell	Associate	22231433, 32506171
Carcinoma Merkel Cell	Associate	17115023, 18408656
Carcinoma Mucoepidermoid	Associate	17342767, 21948244
Carcinoma Mucoepidermoid	Stimulate	37175975
Carcinoma Non Small Cell Lung	Associate	10733773, 10780522, 11092527, 11215279, 11267948, 11390510, 11511786, 11742492, 12412174, 15166262, 15785747, 17699846, 18317076, 18720359, 19141127 View all (50 more)
Carcinoma Non Small Cell Lung	Stimulate	12845630, 21964530, 23049921, 23781133, 33125430
Carcinoma Ovarian Epithelial	Associate	16124061, 19240722, 23202951, 24986540, 25092217, 26098087, 26143638, 26158818, 26264619, 27118139, 28091613, 29308068, 31105696, 33081171, 37320880
Carcinoma Ovarian Epithelial	Stimulate	18075302, 20860602, 21614520, 29770329
Carcinoma Pancreatic Ductal	Stimulate	21847358
Carcinoma Pancreatic Ductal	Associate	22159401, 25176061, 26261495, 28984028, 31956659, 32493953, 37907568, 40269781
Carcinoma Papillary	Associate	24294378
Carcinoma Papillary Follicular	Associate	28425432
Carcinoma Renal Cell	Associate	10669954, 11675683, 11720477, 11846206, 11875741, 12110091, 12115316, 12410931, 12657102, 12696078, 12890841, 16856880, 17100773, 17505508, 17605814 View all (89 more)
Carcinoma Renal Cell	Stimulate	15221993, 21637343, 29251173, 35266008, 8238242
Carcinoma Small Cell	Associate	16014119, 28510571, 35732326
Carcinoma Squamous Cell	Associate	15483346, 17965528, 19387481, 20036889, 20237991, 20349288, 22231433, 22355056, 23098453, 24165149, 25296855, 27413748, 27709850, 27729640, 28174788 View all (10 more)
Carcinoma Squamous Cell	Stimulate	23166713, 33146672
Carcinoma Transitional Cell	Associate	15517881, 23613251, 8238242, 9823778
Carcinoma Verrucous	Stimulate	39412903
Cardiac Complexes Premature	Associate	26172140
Cardiomegaly	Associate	23933698
Cardiomyopathies	Associate	10732896, 16139132, 17297559, 37833902
Cardiomyopathy Dilated	Associate	17297559, 28399937, 37372424
Cardiomyopathy Dilated	Inhibit	20392463
Cardiomyopathy Hypertrophic	Associate	22796508
Cardiomyopathy infantile histiocytoid	Associate	25275525
Cardiovascular Diseases	Associate	15964916, 24718046, 28765276, 35285386, 36005561, 36035865, 39201353, 39762845
Cardiovascular Diseases	Stimulate	40247170
Carotid Artery Diseases	Associate	26881237
Carotid Stenosis	Associate	21206178, 25893670
Carpal Tunnel Syndrome	Associate	26174360
Cartilage Diseases	Associate	11352239, 12507900, 16565972, 22241609
Castleman Disease	Inhibit	28183278
Cataract	Associate	29258473, 39959181
Cavernous Sinus Thrombosis	Associate	26037177
Cell Transformation Neoplastic	Associate	18615482, 32418990
Central Nervous System Diseases	Associate	35449729, 39364412
Central Nervous System Neoplasms	Associate	8380810
Cerebral Arterial Diseases	Associate	31039570
Cerebral Arterial Diseases	Stimulate	31273966
Cerebral Hemorrhage	Associate	21706043, 32769962, 33891558, 35833818, 9342366
Cerebral Infarction	Associate	28234972, 31173308, 36254030, 36426373
Cerebral Palsy	Associate	31039570
Cerebrovascular Disorders	Associate	24260517, 24786777, 34318873, 36479843, 37443201
Charcot Marie Tooth disease Type 2B	Associate	35409401
Chemical and Drug Induced Liver Injury	Associate	18193117
Cholangiocarcinoma	Associate	18087285, 18395502, 20636398, 21492330, 24935374, 26207380, 26762407, 30400838, 30920845, 35558087, 35901327, 37369494
Cholesteatoma	Associate	36837507
Chondroma	Associate	21669154
Chondrosarcoma	Associate	15475194, 24901233, 25106798, 26013170, 32469486
Chondrosarcoma	Stimulate	16565972, 19509297
Chondrosarcoma Extraskeletal Myxoid	Associate	35974707
Chordoma	Associate	34127734
Choroidal Effusions	Stimulate	18515987
Choroidal Effusions	Associate	26825024, 33977746
Choroidal Neovascularization	Associate	15148217, 21245410, 27783271, 30217183, 30498755, 33876574, 34158671, 36543599, 37598400
Choroidal Neovascularization	Inhibit	26915743, 32579694, 32799831, 34486473
Choroiditis	Associate	16687456
Chromosome Disorders	Associate	20733177
Chronic Disease	Stimulate	17852434, 22737245, 9737465
Chronic Kidney Disease Mineral and Bone Disorder	Associate	35962640
Chronic Limb Threatening Ischemia	Associate	14981457, 23653276, 32875492
Chronic Periodontitis	Associate	23264219, 23592000, 26211001
Chronic Urticaria	Stimulate	32339669
Chronic Urticaria	Associate	37804482
Cicatrix	Associate	10903802
Classical Lissencephalies and Subcortical Band Heterotopias	Stimulate	27809226
Clear cell metastatic renal cell carcinoma	Associate	20089566, 21882181, 26312386, 26424759, 26951309, 27407122, 30385613, 40274465
Clear cell metastatic renal cell carcinoma	Inhibit	27751729
Cleft Lip	Associate	33947308
Cleft Palate	Associate	33947308
Cognition Disorders	Associate	23182805, 25751166, 31791659, 34845413
Cognitive Dysfunction	Associate	25751166, 37686198
Colitis Ischemic	Stimulate	15770733
Colitis Ulcerative	Stimulate	12610101, 18159242, 29556626, 30892485
Colitis Ulcerative	Associate	25076849, 32022398, 35484353, 37078344
Colonic Neoplasms	Associate	12003996, 12632503, 14669355, 18032824, 18414651, 19705030, 27513421, 36246978, 39527375
Colonic Neoplasms	Stimulate	17785951
Colorectal Neoplasms	Associate	10408390, 11300331, 11376560, 11687953, 11733561, 11833093, 11857296, 11921018, 12046078, 12632503, 12800229, 12800231, 12853702, 12854171, 14521608 View all (162 more)
Colorectal Neoplasms	Stimulate	19540709, 24240588, 26730158, 28347226, 34092605, 34106269, 38096329
Colorectal Neoplasms	Inhibit	29740162, 32552875
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	35638907
Common Variable Immunodeficiency	Stimulate	34146579
Communicable Diseases	Associate	11813843
Communication Disorders	Associate	35052452
Complement Factor H Deficiency	Associate	24084496
Complex Regional Pain Syndromes	Stimulate	22074333
Condylomata Acuminata	Associate	26662142
Congenital disorder of glycosylation type 1A	Associate	35711443
Congenital Hypothyroidism	Associate	32486504
Constriction Pathologic	Associate	26488115, 36642504
Constriction Pathologic	Stimulate	33518452
Contracture	Associate	14554230, 19214689
Corneal Neovascularization	Associate	19531249, 24866589, 26727921, 30948500, 9527324
Coronary Aneurysm	Inhibit	32022379
Coronary Artery Disease	Associate	17924284, 19920796, 23137122, 24505095, 24736319, 27704620, 27835972, 27994218, 28811677, 38003316, 39614436, 39684689
Coronary Disease	Stimulate	16139132
Coronary Disease	Associate	16151023, 17707181, 24736300, 25683698, 25755796, 26501555, 26726843, 27175642, 35866783, 40184077, 40247170
Coronary Restenosis	Stimulate	24168783
Coronary Restenosis	Associate	28484288
Coronavirus Infections	Associate	33968364
Cough	Associate	35866040, 39465738
COVID 19	Stimulate	32664949
COVID 19	Associate	33052054, 33254543, 34292445, 34556735, 34941025, 35069542, 35305722, 35464051, 35751199, 36890149, 37347115, 37403291, 37466590, 39201353
COVID 19	Inhibit	34718118
Coxa Magna	Associate	16609965, 17698375, 18991344, 19763724, 21710604, 30385772, 31831773, 35035862, 36530027
Craniopharyngioma	Associate	11857307, 24934367, 29952957
Craniopharyngioma	Stimulate	24608455
Crohn Disease	Associate	12610101, 26867730
Crohn Disease	Stimulate	18159242
Cushing's symphalangism	Associate	19565133
Cystic Fibrosis	Stimulate	17382901
Cystic Fibrosis	Associate	21658316, 33387563, 34887365
Cystitis Interstitial	Stimulate	14641413
Cysts	Associate	15193472, 37749004
Cytokine Release Syndrome	Stimulate	25076849, 26424968
Cytomegalovirus Infections	Associate	19554613
Daneman Davy Mancer syndrome	Associate	34644732
Death	Stimulate	16546368, 28245709
Death	Associate	17306350, 18829682, 19920796, 24811984, 24989926, 26587841, 32521872, 33112560, 34440447, 9823983
Death Sudden Cardiac	Associate	23155356
Depressive Disorder	Associate	22832727, 27527872
Depressive Disorder	Stimulate	24718046, 25683698
Depressive Disorder Major	Stimulate	24718046
Dermatitis	Stimulate	20795427
Dermatitis Allergic Contact	Associate	20795427
Dermatitis Atopic	Associate	22413008, 26124183
Dermatitis Atopic	Stimulate	24032555, 28821884
Dermatitis Herpetiformis	Stimulate	7738351
Dermatofibrosarcoma	Associate	34362454
Dermatomyositis	Associate	18821695, 30142763
Diabetes Complications	Associate	35757473
Diabetes Gestational	Associate	20674013, 27606810, 30350881, 31099333
Diabetes Gestational	Inhibit	27645229
Diabetes Gestational	Stimulate	34930438
Diabetes Mellitus	Associate	11110694, 12631341, 15923499, 16139132, 16541023, 19145248, 19539633, 20570185, 20801867, 23106921, 26044558, 26156593, 27175642, 27783271, 30579324 View all (10 more)
Diabetes Mellitus	Stimulate	14554230, 18385799, 19577077, 23303012, 23421785, 34944529
Diabetes Mellitus	Inhibit	16778129, 31676796
Diabetes Mellitus Type 1	Associate	24523574, 25179090, 37468555
Diabetes Mellitus Type 1	Stimulate	39273664
Diabetes Mellitus Type 2	Associate	16139132, 21084393, 22064697, 22162628, 23405237, 24505095, 25587982, 26881237, 27325467, 28662688, 28761062, 30719863, 30787295, 32851081, 33942489 View all (6 more)
Diabetes Mellitus Type 2	Stimulate	23935253, 33906524
Diabetes Mellitus Type 2	Inhibit	34944529
Diabetic Angiopathies	Associate	16151023, 22064697, 29582815
Diabetic Cardiomyopathies	Associate	33909697, 34926700
Diabetic Foot	Associate	29768333, 29901584, 35909542, 36232122, 37365645
Diabetic Nephropathies	Associate	10674029, 11499563, 11912219, 15610240, 16541023, 21752957, 26156684, 28990106, 31277135, 33274236, 35069435, 37038746, 37415174, 37861555, 39273385
Diabetic Nephropathies	Inhibit	17264876, 35637650
Diabetic Neuropathies	Associate	19399887, 40214234
Diabetic Retinopathy	Associate	11499563, 14747470, 15923499, 16202216, 16636650, 17698375, 19145248, 19531249, 20801867, 22064697, 22162628, 23144758, 23405237, 24623964, 25352747 View all (25 more)
Diabetic Retinopathy	Stimulate	20801867, 23106921, 26325091, 29582815, 33328159, 35285425
Diarrhea	Associate	20940716
Diarrhea	Inhibit	28183278
Diarrhea 5 With Tufting Enteropathy Congenital	Stimulate	21316013
Diarrhea 5 With Tufting Enteropathy Congenital	Associate	39412903, 39873996
Disease	Associate	35090332, 35306360
Disease	Stimulate	9737465
Disseminated Intravascular Coagulation	Associate	38319150
Down Syndrome	Associate	23040494, 33260695
Drug Related Side Effects and Adverse Reactions	Associate	15760400, 19240722, 25157767, 26830973, 28031235, 28129643, 28347919, 30197264, 30385613, 34219681
Drug Related Side Effects and Adverse Reactions	Stimulate	33065984
Drug Resistant Epilepsy	Stimulate	23341958
Drug Resistant Epilepsy	Associate	28903476, 34593990
Dry Eye Syndromes	Stimulate	31927552
Dupuytren Contracture	Associate	23992143
Dysmenorrhea	Stimulate	23706331
Dysplastic Nevus Syndrome	Associate	18317782
Dystonia Dopa responsive	Stimulate	31220088
Eales disease	Associate	22025890
Ectodermal Dysplasia	Associate	17543095
Edema	Associate	10704059, 12521215, 16609965, 18796682, 21481277, 21968684, 23818357, 24459428, 25337261, 25878490, 26585263, 31039570, 39533623, 7615975
Edema	Stimulate	24067772
Emanuel syndrome	Stimulate	30206412
Emphysema	Associate	15802335, 18202163
Emphysema	Inhibit	19129286, 22850689
Encephalitis Herpes Simplex	Associate	27313335
Encephalitis Tick Borne	Stimulate	34277474
Endometrial Hyperplasia	Associate	17442020, 19249761, 26429165, 9032563
Endometrial Neoplasms	Associate	10816575, 11710596, 12568850, 12711006, 12942123, 16140938, 16357517, 16557278, 18644593, 19779103, 21103625, 21228924, 22170435, 22640183, 23334331 View all (12 more)
Endometrial Neoplasms	Stimulate	17442020
Endometrial Stromal Tumors	Associate	32673897
Endometriosis	Associate	11594532, 12095505, 12372470, 17482599, 17765237, 17963063, 18644593, 18930211, 22128802, 24133591, 25255852, 26773192, 27323121, 27608888, 27807692 View all (10 more)
Endometriosis	Stimulate	19324337, 21614520, 26577912, 28397725, 34342087, 34920657
Endometritis	Associate	36531509
Endotoxemia	Stimulate	20213923
Enterocolitis	Associate	17353160
Enterocolitis Necrotizing	Associate	31383782, 37272765
Enterocolitis Neutropenic	Associate	21371321
Epilepsy	Associate	22812626
Epilepsy Tonic Clonic	Stimulate	24718046
Epiretinal Membrane	Associate	17229797, 9486038
Epistaxis	Associate	25839219
Epstein Barr Virus Infections	Stimulate	10640727, 16611410
Erdheim Chester Disease	Associate	36005561
Erysipelas	Associate	28512644
Erythema	Associate	10704059, 20795427, 8702976
Erythema elevatum diutinum	Associate	36012487
Erythema Multiforme	Stimulate	7738351
Esophageal Atresia	Stimulate	33121738
Esophageal Neoplasms	Associate	11961303, 12854174, 18837095, 19136271, 19584152, 22994764, 24284961, 25169488, 25640399, 31102307, 31858546, 34157252, 8755119
Esophageal Neoplasms	Stimulate	24803825
Esophageal Squamous Cell Carcinoma	Associate	18023103, 18439605, 21468258, 22134872, 22627741, 23155356, 24945674, 25172294, 25624724, 26323923, 31556558, 32474512, 32662828, 34315926, 35463992, 37752569, 38055382, 9635853 View all (3 more)
Esophageal Squamous Cell Carcinoma	Stimulate	26099724
Esophagitis	Associate	15867486
Esophagitis	Stimulate	35564692
Essential Hypertension	Associate	25945941
Euthyroid Sick Syndromes	Associate	20098841
Eye Diseases	Associate	27768202
Eye Diseases	Stimulate	32184103
Eye Infections Fungal	Associate	17057815
Eyelid Neoplasms	Associate	28174788
Fallopian Tube Diseases	Stimulate	12372470
Familial cerebral cavernous malformation	Stimulate	32556941
Familial Primary Pulmonary Hypertension	Associate	27188753
Fatigue	Associate	25047123
Femur Head Necrosis	Stimulate	24878820
Fetal Diseases	Associate	17105340
Fetal Distress	Associate	26617878
Fetal Growth Retardation	Stimulate	20412591
Fetal Growth Retardation	Associate	23056578, 32049790
Fetal Growth Retardation	Inhibit	32215825
Fever	Inhibit	12085210, 28183278
Fever	Associate	21371321
Fever	Stimulate	27787523
Fibroma Desmoplastic	Associate	20305325
Fibromatosis Aggressive	Associate	35048638
Fibromyalgia	Associate	37958517
Fibrosis	Associate	15760400, 17786144, 18256065, 19589268, 23091809, 23303012, 24577260, 26807786, 28424250, 29334947, 31220088, 34522168, 37157945, 37266443, 38259488, 40190527 View all (1 more)
Fibrosis	Stimulate	18300343, 37861555
Fibular hypoplasia and complex brachydactyly	Associate	17024232
Flatfoot	Associate	18304793, 39533623
Focal cortical dysplasia of Taylor	Associate	18317782
Focal Nodular Hyperplasia	Associate	30678450, 32058355
Fractures Bone	Associate	16609965, 36749277, 39768988
Fumaric aciduria	Associate	33658299
Gallbladder Neoplasms	Associate	15309734, 15968728, 16489641, 18676870, 21853312, 25632198
Gallbladder Neoplasms	Stimulate	38554345
Gangrene	Stimulate	15531204
Gardner Syndrome	Associate	33682749
Gastritis Atrophic	Associate	11978184
Gastro enteropancreatic neuroendocrine tumor	Associate	21245995, 29787601
Gastroesophageal Reflux	Associate	26151457, 35564692
Gastrointestinal Diseases	Associate	26194361
Gastrointestinal Hemorrhage	Associate	20593045, 25839219
Gastrointestinal Neoplasms	Associate	14669355, 21330783, 28594907
Gastrointestinal Stromal Tumors	Associate	16521182, 17036392, 17299397, 21977985, 22439647, 23408993, 24124608, 25987131, 26078569, 26576593
Geographic Atrophy	Associate	24084496, 25542520
Giant Cell Arteritis	Associate	21989653, 34204585, 35349405
Giant Cell Tumor of Bone	Associate	25929323, 35695550
Gingivitis	Stimulate	25861162
Gingivitis	Associate	29149180
Glaucoma	Stimulate	32043817
Glaucoma	Associate	33746571
Glaucoma Angle Closure	Associate	26748993
Glaucoma Angle Closure	Stimulate	36254076
Glaucoma Open Angle	Associate	26820987, 32043817
Glioblastoma	Associate	10336429, 10864205, 11741977, 11912213, 12445161, 12918061, 12937144, 15973775, 16175187, 17075581, 17132220, 18796682, 18804099, 19291283, 19349600 View all (53 more)
Glioblastoma	Stimulate	20458050, 23787764, 32074192, 33199490, 33807899, 35392912, 38036978, 39196480
Glioma	Associate	10389985, 10682677, 10864205, 11324417, 15814920, 16042757, 16212813, 16357523, 16900782, 17075581, 17611402, 18781179, 19671762, 20838435, 21517260 View all (36 more)
Glioma	Stimulate	26473373
Glioma of Brain Familial	Associate	29745085
Glomerulonephritis	Associate	17994443, 24577260, 24673399
Glomerulonephritis IGA	Associate	16526314, 29137483
Glomerulonephritis Membranous	Associate	25875837
Glomerulosclerosis Focal Segmental	Associate	21372519, 21978756
Glucose Intolerance	Inhibit	22915762
Glucosephosphate Dehydrogenase Deficiency	Associate	11917134, 32630408
Glycogen Storage Disease Type II	Inhibit	21245410
Glycogen Storage Disease Type II	Associate	22848690, 32106291, 35326447
Glycogen Storage Disease Type IV	Associate	16518330
Goiter	Associate	32824922
Goiter Multinodular 2	Associate	17696908, 34644732
Goiter Nodular	Associate	28178662
Graft vs Host Disease	Inhibit	19041064
Graft vs Host Disease	Associate	19041064
Granuloma	Stimulate	32823472
Granuloma Giant Cell	Stimulate	26925662
Granuloma Pyogenic	Associate	10598753
Granulosa Cell Tumor	Associate	37316921
Graves Disease	Associate	17696908, 27494076, 32074519, 35008579
Graves Ophthalmopathy	Associate	18797655, 27423310, 35008579
Growth Disorders	Associate	10780661, 33541438
Growth Hormone Secreting Pituitary Adenoma	Associate	29334118
Hallucinations	Associate	30310054
Hand Arm Vibration Syndrome	Associate	40460899
Hand Foot Syndrome	Associate	22736425, 26830973
Hantavirus Infections	Stimulate	20810734
Hantavirus Pulmonary Syndrome	Associate	20810734
Hashimoto Disease	Associate	27494076, 32074519, 32615729, 33916948
Haspeslagh Fryns Muelenaere syndrome	Stimulate	22975656
Head and Neck Neoplasms	Associate	11326316, 15330158, 15475932, 16641910, 20098841, 20237991, 21480395, 26171937, 35806488, 38376273
Headache	Associate	32718338
Heart Arrest	Associate	31237169
Heart Defects Congenital	Stimulate	16127192
Heart Defects Congenital	Associate	24811984, 27450023, 33260695, 34313777
Heart Diseases	Associate	33260695, 34887365, 36598310, 39201353
Heart Failure	Associate	15951350, 23155356, 28790053, 29784904, 32839603, 34724901, 40247170
Heart Septal Defects Ventricular	Associate	33757570, 35870951, 36759823
Helicobacter Infections	Stimulate	15929167, 27198692
HELLP Syndrome	Associate	37950229
Hemangioblastoma	Associate	11986247, 23638216, 25310734, 26920352, 8774132, 9665461, 9787178
Hemangioendothelioma Epithelioid	Associate	20104492
Hemangioma	Associate	18814928, 22900063, 29664206, 30070315, 9811333
Hemangioma	Stimulate	24704994, 25816398
Hemangioma Capillary	Associate	25807908
Hemangioma capillary infantile	Associate	20872175, 29664206, 30070315, 32091151
Hemangioma Cavernous	Associate	18814928, 28169248
Hemangioma Cavernous Central Nervous System	Associate	28181149, 32556941, 40519934
Hemangiopericytoma	Stimulate	8774132
Hemangiosarcoma	Associate	15015593, 31004117, 31510873, 32912994, 8644848, 9811333
Hematoma	Stimulate	19779281
Hematoma	Associate	21409457, 24067772
Hematoma Subdural Chronic	Associate	19779281, 24305026
Hematuria	Associate	36899322
Hematuria Benign Familial	Associate	26318037
Hemihyperplasia Isolated	Stimulate	27910891
Hemiplegia	Associate	36820574
Hemochromatosis	Stimulate	23287320
Hemoglobinopathies	Associate	29061162
Hemolysis	Associate	11943725
Hemolytic Uremic Syndrome	Associate	30041762
Hemolytic Uremic Syndrome	Stimulate	33641611
Hemoptysis	Stimulate	11813843
Hemorrhage	Associate	19201650, 21206178, 21706043, 23594677, 27503021, 31039570, 31217347, 33211216
Hemorrhagic Stroke	Associate	31293107
Hemorrhagic Stroke	Stimulate	39969331
Hepatic Veno Occlusive Disease	Associate	21330458, 26790967
Hepatitis B	Stimulate	23485556, 27861157
Hepatitis C	Associate	16627984, 19944696, 34644732
Hepatitis C	Stimulate	20483710
Hepatitis C Chronic	Associate	29055924
Hepatitis Chronic	Associate	23091809
Hepatoblastoma	Associate	32146800, 34978260
Hereditary Breast and Ovarian Cancer Syndrome	Associate	19574499, 21390493, 25448984, 30394935, 31752829, 32393308
Hereditary Myopathy with Early Respiratory Failure	Stimulate	16546368
Heredodegenerative Disorders Nervous System	Associate	35347084
Hernias Diaphragmatic Congenital	Stimulate	10212108
Hernias Diaphragmatic Congenital	Inhibit	26333573
Hip Injuries	Associate	22035487
Hippocampal Sclerosis	Associate	22812626
Histiocytosis Langerhans Cell	Associate	36714021
HIV Infections	Stimulate	10361120, 18840277, 27830756, 32849508
HIV Infections	Associate	15868898, 19712456
Hodgkin Disease	Associate	24141626, 24489836
Huntington Disease	Inhibit	25915065
Huntington Disease	Associate	32074519
Hydrothorax	Stimulate	25635424
Hyperaldosteronism	Stimulate	23626817
Hyperglycemia	Associate	20674013, 25401697, 28680264
Hyperglycemia	Inhibit	27606810, 39329718
Hyperglycemia	Stimulate	28840773, 29582815, 33065984, 33328159, 33709000
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	20674013, 28840773
Hyperglycemic Hyperosmolar Nonketotic Coma	Stimulate	25878490, 26800359, 28465657
Hyperostosis corticalis deformans juvenilis	Associate	32527320
Hyperoxia	Associate	19734318, 29334947
Hyperoxia	Inhibit	33215223, 33632168
Hyperplasia	Associate	10337031, 11380837, 18459027, 19623180, 8644848
Hyperplasia	Stimulate	17452774
Hypersensitivity Immediate	Stimulate	20052595
Hypertension	Associate	18824714, 21882181, 24786777, 24959596, 25047123, 26044558, 26400342, 27175642, 27367286, 32175644, 33541438, 33652665, 34775477, 34797313, 35075138, 35365727 View all (1 more)
Hypertension	Inhibit	33760199
Hypertension	Stimulate	39595551
Hypertension Pregnancy Induced	Associate	24801045, 24959596, 37716201
Hypertension Pulmonary	Associate	10212108, 28514291, 31703702, 36483920
Hypertension Renal	Associate	27367286
Hypertensive Retinopathy	Associate	15923499, 23901275, 28662688, 30579324, 30719863
Hypertrophy	Associate	21484051, 25279550, 27307356, 31409892
Hyperuricemia	Associate	26299712
Hypoglycemia	Stimulate	16219663
Hypomagnesemia primary	Associate	20036889, 27313335
Hypomagnesemia primary	Stimulate	23625598
Hypoplastic Left Heart Syndrome	Associate	34313777
Hypothermia	Inhibit	26223306
Hypothyroidism	Associate	22439647
Hypothyroidism Congenital Nongoitrous 2	Inhibit	35459174
Hypotrichosis	Inhibit	37759728
Hypoxia	Stimulate	10358107, 10389985, 10408392, 10587522, 11115828, 11707426, 11774032, 11912213, 11953885, 11971899, 12110091, 12173346, 12384916, 12401798, 12761217 View all (135 more)
Hypoxia	Associate	11813843, 12161185, 12885785, 14604996, 14676809, 14726398, 15113858, 16219663, 17205120, 17406354, 17608772, 17999771, 18227840, 18283323, 18329003 View all (83 more)
Hypoxia	Inhibit	20927579
Hypoxia Brain	Stimulate	10607702, 11023511, 11050001, 11115828, 11971899, 12356354, 12401798, 14600132, 15793304, 16042757, 16543245, 16856880, 18174379, 18270456, 19091749 View all (19 more)
Hypoxia Brain	Associate	11953885, 15015593, 16543242, 16732616, 18528739, 19144048, 20018810, 20067638, 20671264, 21628883, 21660298, 22086907, 22705563, 24305704, 24959596 View all (13 more)
Hypoxia Ischemia Brain	Associate	33997006
Hypoxia Ischemia Brain	Stimulate	35340230
Idiopathic Noncirrhotic Portal Hypertension	Inhibit	18193117
Idiopathic Noncirrhotic Portal Hypertension	Associate	19177438, 19589268, 26820153, 36853298
Idiopathic Pulmonary Fibrosis	Associate	18829682, 20483575, 29334947, 31660581, 34522168, 34948231
Idiopathic Pulmonary Fibrosis	Stimulate	20169144, 23341966, 28128990
IgA Vasculitis	Associate	12115224, 19558800, 28691415
Immunodeficiency due to Defect in MAPBP Interacting Protein	Inhibit	38017409
Infant Newborn Diseases	Associate	25951999
Infarction	Associate	10699162
Infarction Anterior Cerebral Artery	Associate	32506171
Infections	Stimulate	10361120, 15254407, 16254334, 23836663, 32418990, 36482106
Infections	Associate	15542692, 25885541
Inferior Wall Myocardial Infarction	Associate	31967688, 36820574, 37119591
Infertility	Associate	24471989, 26586929
Inflammation	Associate	10706506, 11212152, 11398859, 11594532, 11710707, 11813843, 12057924, 12847684, 15016650, 16343055, 17105340, 17698375, 18758633, 19176759, 19300368 View all (93 more)
Inflammation	Stimulate	17297559, 19240164, 22025890, 22307011, 23166713, 23303012, 24718046, 25417001, 27720318, 28951386, 32594304, 33801351, 34502489, 35502507, 35661979
Inflammation	Inhibit	27775667, 27998768, 31363137, 36899322
Inflammatory Bowel Diseases	Associate	21637825, 30892485
Inflammatory Breast Neoplasms	Associate	18248671, 22813402, 36873124
Insulin Resistance	Associate	22471305, 26871994, 31786572, 32651353, 33274236
Intervertebral Disc Degeneration	Associate	23317892, 23884772, 24361793, 25209447, 28586059, 29364361, 33764282, 37266623, 38041088, 38095643, 40190527
Intervertebral disc disease	Associate	23884772, 40190527
Intervertebral Disc Displacement	Associate	28260009, 9093829
Intestinal Diseases	Stimulate	11978184
Intestinal Diseases	Associate	18273500, 19331191
Intestinal Neoplasms	Associate	18266006, 23303024, 24322015
Intestinal Neoplasms	Stimulate	18516318
Intestinal Obstruction	Associate	35528155
Intestinal Polyposis	Stimulate	19762561
Intraabdominal Infections	Associate	31480453
Intracranial Aneurysm	Associate	30497276, 37041519, 37573538
Intracranial Arteriosclerosis	Associate	30392834, 32506171
Intracranial Arteriovenous Malformations	Associate	21706043, 22643235, 24517927
Intracranial Hemorrhage Traumatic	Associate	24067772
Intrahepatic Cholestasis of Pregnancy	Associate	25001852, 26617878
Invasive Pulmonary Aspergillosis	Associate	24712925
Iridocyclitis	Associate	35178133
Iron Deficiencies	Associate	25839219
Ischemia	Associate	10699162, 12095313, 23137122, 28362162, 30392834, 34099465
Ischemia	Stimulate	11029398, 31273966
Ischemia	Inhibit	36232122
Ischemic Attack Transient	Associate	33076256
Ischemic Stroke	Associate	22203935, 32576868, 35673992, 37338050
Jaw Diseases	Inhibit	22864527
Jejunal Neoplasms	Associate	34465291
Job Syndrome	Stimulate	29985426
Joint Diseases	Associate	21163925, 30420902
Juvenile osteoporosis	Associate	37967683
Keloid	Associate	25369801, 36316928
Keratoacanthoma	Associate	12439721
Keratoconus	Associate	36051483
Kidney Diseases	Associate	10674029, 12631341, 15140761, 19139726, 19295501, 19483746, 19917374, 21978756, 24577260, 25875837, 26722454, 28662688, 30579324, 30719863, 31077056, 34870494 View all (1 more)
Kidney Diseases	Inhibit	25951999
Kidney Failure Chronic	Associate	15347709, 16526314
Kidney Failure Chronic	Stimulate	24471420
Kidney Failure Chronic	Inhibit	31875015
Kidney Neoplasms	Associate	10669954, 19295501, 21886838, 22573349, 23752066, 29022645, 30093597, 31600176, 36176934, 37455529, 38413252
Kidney Neoplasms	Inhibit	19483746
Kidney Neoplasms	Stimulate	21637343
Klatskin Tumor	Stimulate	26657503
Knee Injuries	Associate	26996575
Krukenberg Tumor	Associate	16124061
Laryngeal Diseases	Associate	35513993
Laryngeal Neoplasms	Associate	17183558, 24081562, 26457244, 33099940, 35900477
Laryngitis	Associate	23071866
Leiomyoma	Associate	17036392, 20443739, 22685266, 28010141, 28338206, 28600036, 34942165, 36313223, 36771423
Leiomyoma	Inhibit	27748285
Leiomyoma	Stimulate	34256950
Leiomyosarcoma	Associate	29295562
Leprosy	Associate	27706378
Leukemia	Associate	11222390, 11877295, 11895790, 11964307, 12843001, 12901974, 12917408, 16164827, 16249383, 20237090, 25422204, 26191229, 29400343, 30909668, 33146708, 35449729, 9058706, 9529385 View all (3 more)
Leukemia	Inhibit	14996703
Leukemia Biphenotypic Acute	Associate	16266864
Leukemia Lymphocytic Chronic B Cell	Associate	10887147, 11050001, 12358901, 14996703, 19336759, 19965686, 20018914, 20164467, 20382847, 21519633, 21733558, 23091809, 23335070, 23475487, 24883303 View all (6 more)
Leukemia Lymphocytic Chronic B Cell	Stimulate	15558070
Leukemia Lymphoma Adult T Cell	Associate	20237090
Leukemia Monocytic Acute	Associate	23648122
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	11877311, 18534064, 19875757, 22511990, 24129092, 26502845, 30476925
Leukemia Myelogenous Chronic BCR ABL Positive	Stimulate	14976047, 25831205
Leukemia Myeloid Acute	Stimulate	11222390, 12404286, 28084439, 28636974, 30909668
Leukemia Myeloid Acute	Associate	11994978, 12843001, 16249383, 19404919, 19463770, 22664115, 23155356, 23509773, 24966925, 25422204, 29699374, 32783661, 33318617, 9058706
Leukemia Myeloid Acute	Inhibit	39993966
Leukemia Myelomonocytic Chronic	Associate	11222390
Leukemia Myelomonocytic Chronic	Stimulate	30026572
Leukemia Plasma Cell	Associate	11435313
Leukemia Prolymphocytic T Cell	Associate	24971577, 28233872
Leukemia T Cell	Associate	17983459, 21535412
Leukemic Infiltration	Associate	20932296
Leukoplakia Oral	Stimulate	39261828
Lichen Planus Oral	Associate	19680199
Lichen Planus Oral	Stimulate	39261828
Lipedema	Inhibit	32616854
Lipedema	Associate	36385154
Lipoma	Associate	37194849
Liposarcoma	Associate	21598240, 25973067, 32493092
Liver Cirrhosis	Associate	15742396, 26299203, 27982164, 28837651, 29055924, 29604220, 33673041, 36853298
Liver Cirrhosis Biliary	Associate	11710707
Liver Diseases	Associate	16636650, 17353160, 17786144, 18193117, 18814928, 28837651, 35349405
Liver Failure	Associate	18814928, 33647018
Liver Failure	Inhibit	21175804
Liver Failure Acute	Inhibit	21175804
Liver Neoplasms	Associate	35426263
Low Back Pain	Associate	23884772
Lumbar Stenosis Familial	Associate	34751419
Lung Diseases	Associate	11813843, 12668796, 16546368, 20348277, 22795057, 26424968, 34717573
Lung Diseases	Stimulate	15113858
Lung Diseases Interstitial	Stimulate	31732480
Lung Injury	Associate	11471568, 12653578, 19327291, 19403854, 22921855, 29334947
Lung Neoplasms	Associate	10870646, 10925736, 11092527, 12161185, 12209728, 12576459, 12845630, 17024232, 18590539, 18671849, 19337377, 20349288, 20712888, 22231433, 22320189 View all (26 more)
Lung Neoplasms	Stimulate	25919050, 26109366
Lupus Erythematosus Systemic	Stimulate	17964973
Lupus Erythematosus Systemic	Associate	20805419, 28343620, 35864995
Lupus Nephritis	Inhibit	19295501, 20805419
Lupus Nephritis	Associate	19483746, 36335193
Lupus Vasculitis Central Nervous System	Associate	28343620
Lymphangioma	Associate	11742043
Lymphatic Diseases	Inhibit	28183278
Lymphatic Metastasis	Associate	10424737, 11511786, 11687953, 12854133, 12854174, 14669355, 15029262, 15112337, 15741767, 16799477, 16807982, 17972532, 18023103, 20205278, 20459642 View all (30 more)
Lymphatic Metastasis	Stimulate	11092527, 12174362, 12460468, 14657950, 15309707, 16827115, 17094486, 17353919, 17409493, 17461470, 17785951, 18200665, 21316013, 21718596, 22644676 View all (9 more)
Lymphoma	Associate	11426493, 15311211, 16156857, 17998899, 19821819, 22322190, 26121143
Lymphoma B Cell	Associate	21935869
Lymphoma B Cell	Stimulate	23624620
Lymphoma Large B Cell Diffuse	Associate	17392174, 17694324, 17998899, 19821819, 22129133, 34219681, 36567775, 37647140
Lymphoma Large Cell Anaplastic	Associate	11426493
Lymphoma Mantle Cell	Associate	22915070
Lymphoma Non Hodgkin	Associate	11841410, 15814920, 19373598, 22190165, 23998120, 24885312
Lymphoma Non Hodgkin	Stimulate	23091809
Lymphoma Non Hodgkin	Inhibit	27797254
Lymphoma Primary Effusion	Associate	11841405, 15705790
Lymphoma T Cell	Associate	15311211, 19120365, 22322190
Macrophage Activation Syndrome	Associate	37020848
Macular Degeneration	Associate	19386604, 19834034, 20019880, 20228934, 20811156, 21566137, 21597483, 21878851, 21917937, 22312192, 22355348, 22408008, 22419845, 23112570, 23337555 View all (54 more)
Macular Degeneration	Inhibit	27009515, 28266609, 30820144, 32579694, 33075294
Macular Degeneration	Stimulate	28231837, 33113897, 34794403, 35370941
Macular dystrophy corneal type 1	Inhibit	34794403
Macular Edema	Stimulate	20980427, 24319335, 33906524
Macular Edema	Inhibit	26978887, 32507488, 33075294, 40069099
Macular Edema	Associate	27783271, 29303154, 31451777, 32896498, 34211611, 34967360, 35409401, 36581632
Malaria	Associate	17105340, 20716170
Malaria Falciparum	Associate	20716170
Malformations of Cortical Development Group I	Inhibit	11331362
Malignant Teratocarcinosarcoma	Associate	19762561
Mammary Neoplasms Animal	Associate	17611397, 24015760
Mandibular Nerve Injuries	Associate	35354377
Mast Cell Activation Disorders	Associate	31708535
Mastocytosis	Stimulate	33687603
Mastocytosis Systemic	Associate	12000716, 20716170
Medulloblastoma	Associate	17704359, 25794107, 33589929
Meibomian Gland Dysfunction	Associate	35468976
Meige Syndrome	Inhibit	17944915
Melanoma	Associate	10414467, 10873988, 11121133, 12404291, 14632212, 14660675, 15610528, 16801397, 16946713, 17595666, 18288398, 18996182, 19240164, 19478386, 19794965 View all (26 more)
Melanoma	Stimulate	17932890, 31758648, 34354552, 35538545
Melanosis	Associate	29455565
Melorheostosis	Associate	35189151
Meningioma	Associate	20052595, 23047550, 23818357, 25681310, 25821815, 29858948, 32756218, 33099292, 40652475
Meningioma	Stimulate	33528717
Menorrhagia	Stimulate	16169405
Menorrhagia	Associate	17336974, 19406397
Mesothelioma	Associate	23585849
Mesothelioma Malignant	Associate	10487612, 16619474, 17214348, 20838437, 24790010, 34261675
Metabolic Diseases	Associate	32160900
Metabolic Syndrome	Associate	19223316, 25423914, 28191276, 28212431, 28763032, 31405227, 31786572, 32160900
Metabolism Inborn Errors	Associate	11943725
Metrorrhagia	Stimulate	19249761
Microscopic Polyangiitis	Associate	16546368
Migraine Disorders	Associate	28918499
Mitochondrial Diseases	Associate	34424263
Mitochondrial Encephalomyopathies	Associate	33655764
Mouth Diseases	Associate	12095505, 19324337, 28811677
Mouth Neoplasms	Associate	22836510, 25804797, 31711427, 36172677, 38376273
Movement Disorders	Associate	37098452
Moyamoya Disease	Associate	23077562, 28596558, 30392834, 36674749, 37684266
Mucocutaneous Lymph Node Syndrome	Associate	32808647
Mucocutaneous Lymph Node Syndrome	Stimulate	34434074
Multi centric Castleman's Disease	Associate	31077056, 31408438
Multi centric Castleman's Disease	Stimulate	34686774, 36990774
Multiple Endocrine Neoplasia Type 2a	Associate	23106811
Multiple Myeloma	Associate	10753844, 11435313, 11751905, 11830495, 12101201, 12714512, 14717786, 16278310, 16487170, 17981009, 19383353, 20652971, 24141333, 24374814, 25769101 View all (9 more)
Multiple Myeloma	Stimulate	16258629, 20097882, 24355943
Multiple Myeloma	Inhibit	24091729
Multiple Organ Failure	Associate	34177897
Multiple Pulmonary Nodules	Associate	18590539, 36384712
Multiple Sclerosis	Stimulate	16295526
Multiple Sclerosis	Inhibit	21573104
Multiple Sclerosis	Associate	27424135
Multiple Sclerosis Chronic Progressive	Inhibit	21573104
Muscle Neoplasms	Associate	19692168
Muscular Atrophy	Associate	20932296
Muscular dystrophy congenital with central nervous system involvement	Associate	35449729
Muscular Dystrophy Duchenne	Associate	36619896
Myelodysplastic Syndromes	Associate	10604739, 11222390, 12100142, 23155356
Myelodysplastic Syndromes	Stimulate	20679526
Myeloproliferative Disorders	Stimulate	14530810
Myocardial Infarction	Associate	10732896, 23155356, 26861446, 27835972, 34799616, 35378513, 39766291
Myocardial Infarction	Stimulate	19019194, 25417001, 32399898, 34275376
Myocardial Ischemia	Stimulate	11279416
Myocardial Ischemia	Associate	15770733, 20847963, 21206178, 22643235, 23926105, 24047149, 28765276, 32596444
Myoma	Stimulate	20443739
Myoma	Associate	27306124
Myopathies Structural Congenital	Associate	35169858
Myopathy with Giant Abnormal Mitochondria	Stimulate	34424263
Myopia	Associate	31776299, 37759728
Myositis	Associate	20801867, 23840094, 30142763
Myotonic Dystrophy	Stimulate	26211001
Myotonic Dystrophy	Associate	34889890
Myotonic Dystrophy	Inhibit	35751644
Myxoma	Associate	10612767, 15118294, 26193215
Nasal Polyps	Associate	10706506, 27091669, 36304979
Nasal Polyps	Stimulate	28842563
Nasopharyngeal Carcinoma	Associate	11381123, 18171482, 18570662, 19293812, 20847590, 20964870, 22952803, 24504675, 24877105, 32448862, 33099941, 33875643, 37925811, 39304953
Nasopharyngeal Carcinoma	Inhibit	30151927
Nasopharyngeal Neoplasms	Associate	31786874
Nasopharyngeal Neoplasms	Stimulate	33545035
Necrosis	Associate	10682677, 10873988, 21199795, 25823012, 29854577, 31688595, 33446784, 8644848
Necrosis	Stimulate	11115828, 15793304
Nemaline myopathy 5	Associate	17183558
Neointima	Associate	12759245, 30953268
Neoplasm Invasiveness	Associate	11176129, 11953885, 25283528, 26068766, 27503021, 28347226, 30049191
Neoplasm Invasiveness	Stimulate	14657950, 15167937, 15786555, 27936049
Neoplasm Metastasis	Associate	10944602, 11267948, 12003996, 12298426, 12439912, 12647634, 12853702, 12854133, 12854174, 12917408, 12954624, 14738568, 15118294, 15309734, 15322087 View all (114 more)
Neoplasm Metastasis	Stimulate	11159211, 11176129, 11376560, 11875737, 15500293, 15742396, 17353919, 18317076, 20953377, 22549243, 22890443, 23015149, 24022309, 24420153, 25824321 View all (6 more)
Neoplasm Micrometastasis	Associate	11267948
Neoplasm Residual	Associate	21308293
Neoplasms	Associate	10023341, 10188906, 10336429, 10360662, 10424737, 10487612, 10551327, 10574263, 10595926, 10638984, 10682677, 10705399, 10741909, 10748050, 10780522 View all (830 more)
Neoplasms	Stimulate	10669954, 10870646, 11978184, 12412796, 12509426, 12579092, 12647634, 14504053, 15483346, 16052224, 16432214, 16543242, 17214745, 17452774, 18515987 View all (38 more)
Neoplasms	Inhibit	12379772, 17100773, 17392976, 18644116, 20697987, 22321154, 23633104, 25135429, 26628061, 27341002, 34285262
Neoplasms Bone Tissue	Associate	31831773
Neoplasms Cystic Mucinous and Serous	Stimulate	33387563
Neoplasms Cystic Mucinous and Serous	Associate	37749004
Neoplasms Ductal Lobular and Medullary	Inhibit	12402149
Neoplasms Germ Cell and Embryonal	Associate	25085632, 26199392
Neoplasms Glandular and Epithelial	Associate	37428914
Neoplasms Mesothelial	Associate	14656993
Neoplasms Neuroepithelial	Associate	19661344
Neoplasms Squamous Cell	Associate	31322197, 31556558
Neoplasms Vascular Tissue	Associate	36147560
Nephritis	Associate	19558800
Nephritis Hereditary	Stimulate	26274923
Nephrosis congenital	Inhibit	19225555
Nephrosis Lipoid	Associate	21978756, 24213003
Nephrotic Syndrome	Associate	34873575, 35837376
Nerve Degeneration	Associate	16421133, 17456229, 18317782, 24718046
Nervous System Diseases	Associate	30719863, 36820574
Nervous System Neoplasms	Associate	9787178
Neural Tube Defects	Associate	11426493
Neuralgia	Stimulate	35354377
Neuralgia	Associate	37877615
Neurilemmoma	Associate	17036392, 33025139
Neurobehavioral Manifestations	Associate	37834363
Neuroblastoma	Associate	11815985, 18278068, 19540207, 19895696, 20179233, 23155231, 24439602, 24815448, 25292042, 28111925, 28259965, 32295184, 32336043
Neuroblastoma	Stimulate	17088992, 19661350
Neurodegenerative Diseases	Associate	21573104, 31332262
Neurodegenerative Diseases	Inhibit	25751166
Neuroendocrine Tumors	Stimulate	15029262
Neuroendocrine Tumors	Associate	26984080, 31228945, 8826857
Neurofibroma Plexiform	Stimulate	21703400
Neurofibrosarcoma	Associate	20686603, 25833823
Neuroma Acoustic	Associate	19587327, 25692621, 27819721, 30953268, 37862593
Neutropenia	Associate	20940716
Neutrophil Immunodeficiency Syndrome	Associate	38204755
Nevus Pigmented	Associate	17932890
Non alcoholic Fatty Liver Disease	Associate	34006921
Non Muscle Invasive Bladder Neoplasms	Associate	9823778
Non ST Elevated Myocardial Infarction	Associate	40247170
Nonseminomatous germ cell tumor	Stimulate	14504053
Nose Diseases	Associate	19762561
Obesity	Associate	19074987, 20057362, 21203453, 23303012, 25116954, 27015185, 29115082, 32160900, 34429108, 35090332, 37047308, 37219669, 37878496
Obesity	Stimulate	20430377, 23935253, 27677832
Obesity	Inhibit	29784904
Obesity Abdominal	Associate	34048505
Obesity Maternal	Associate	27645229, 33880547, 35177223
Obesity Metabolically Benign	Associate	34230580
Obstetric Labor Premature	Inhibit	28429366
Oculocerebrorenal Syndrome	Associate	11943725
Oculomotor Nerve Diseases	Stimulate	22990551
Odontogenic Cysts	Associate	28721991
Odontogenic Tumors	Associate	26458594
Optic Atrophy	Associate	37946484
Optic Nerve Glioma	Associate	12356354
Optic Nerve Neoplasms	Stimulate	25337214
Optic Neuropathy Ischemic	Stimulate	21418620
Optic Neuropathy Ischemic	Associate	21989653
Oral Submucous Fibrosis	Associate	37157945
Oral Submucous Fibrosis	Stimulate	39261828
Oral Ulcer	Associate	28619073
Organizing Pneumonia	Associate	37376606
Oropharyngeal Neoplasms	Associate	23155356, 39287165
Osteoarthritis	Stimulate	15731292, 17187682, 23935253, 25341039, 26090403, 27989872, 30186872, 34502489, 38203564
Osteoarthritis	Associate	16732616, 19890996, 20060952, 20581375, 23671648, 26996575, 27916780, 31467907, 31662989, 32131466, 32572904, 33853636, 33953899, 36314121, 36769248 View all (7 more)
Osteoarthritis	Inhibit	29258882
Osteoarthritis Hip	Associate	36769248, 38200556
Osteoarthritis Knee	Associate	24297611, 26996575, 29945585, 31662989, 34983993, 36314121, 36529415, 39354436
Osteoarthropathy Primary Hypertrophic	Stimulate	21963742
Osteochondritis	Associate	30483788
Osteolysis	Associate	29328414
Osteolysis Essential	Associate	26238450
Osteonecrosis	Associate	16609965, 19763724, 22287106, 25820558
Osteoporosis	Associate	29518117, 31747953, 33499313, 36147560, 36626454
Osteoporosis	Inhibit	32427128
Osteosarcoma	Associate	16528367, 18528739, 19670450, 20158913, 21495021, 22472569, 22855059, 23015149, 23740448, 24310504, 24330824, 25337211, 25418192, 25550863, 25966208 View all (20 more)
Osteosarcoma	Stimulate	27777493, 39768988
Ovarian Cysts	Associate	18053993
Ovarian Diseases	Inhibit	12095505, 23749764
Ovarian Diseases	Associate	15193472, 15337760, 18053993, 23029477, 32619126, 33277847, 37883761, 38037065
Ovarian Hyperstimulation Syndrome	Associate	21269615, 22587628, 24603682, 24851136, 29843716, 31996061, 32152452, 32945993
Ovarian Hyperstimulation Syndrome	Inhibit	28820403
Ovarian Hyperstimulation Syndrome	Stimulate	32152452
Ovarian Neoplasms	Associate	10901370, 11487257, 11641398, 12023962, 14534882, 15274387, 15347673, 17419711, 18075302, 18337445, 18376140, 19010874, 19028702, 19147754, 19253105 View all (44 more)
Ovarian Neoplasms	Stimulate	11071270, 14606105, 15337760, 20177148, 24374756
Ovarian Neoplasms	Inhibit	25374251, 32727400
Overweight	Associate	19074987, 20057362, 28798202
Overweight	Stimulate	22609636
Paget Disease Extramammary	Associate	26045818
Pain	Stimulate	11398859, 36769248
Pain	Associate	14554230, 19775917, 22074333, 23864770, 29945585, 30597276, 31662989, 33025139, 37958517
Pancreatic Cyst	Associate	33387563, 34166836
Pancreatic Neoplasms	Associate	10188906, 12298426, 12937141, 14604996, 14760765, 15476280, 15558070, 15952180, 16482630, 16532435, 17568185, 17968710, 18307536, 19575490, 20354770 View all (30 more)
Pancreatic Neoplasms	Stimulate	9665487
Pancreatitis	Associate	20495748, 21655646, 28730233
Pancreatitis Chronic	Associate	20495748
Papillary Thyroid Microcarcinoma	Associate	27936049
Papilloma	Associate	26662142
Papillomavirus Infections	Stimulate	18840277
Papillomavirus Infections	Associate	26666815, 30338794
Paraneoplastic Syndromes	Inhibit	32771066
Parkinson Disease	Associate	21407216, 33504893, 34660782, 37834363
Parkinson Disease	Stimulate	22382585, 24189015, 25533682
Parkinsonian Disorders	Stimulate	39412903
Parotid Neoplasms	Stimulate	23231994
Paroxysmal ventricular fibrillation	Associate	21315342
Pediatric Obesity	Associate	35460699, 36822266
Peeling Skin Syndrome	Associate	33880547
Pelvic Pain	Stimulate	27759451
Pemphigoid Bullous	Stimulate	7738351
Pemphigoid Bullous	Associate	8702976
Peptic Ulcer	Associate	18806258
Peri Implantitis	Associate	26424287, 36901702
Peri Implantitis	Stimulate	35344630
Periapical Abscess	Stimulate	34539639
Periodic fever familial autosomal dominant	Stimulate	31009059
Periodontal Diseases	Associate	27058371, 39337647
Periodontitis	Associate	25861162, 27058371, 37749912
Peripheral Arterial Disease	Stimulate	16443741
Peripheral Arterial Disease	Associate	20382861, 22064697, 24657063, 30104096
Peripheral Arterial Disease	Inhibit	24157526
Peripheral Nervous System Diseases	Associate	28662688, 35069435
Peripheral Vascular Diseases	Associate	19889554
Periprosthetic Fractures	Associate	35306116
Peritoneal Diseases	Stimulate	12095505, 12524084
Peritoneal Fibrosis	Stimulate	25384022, 25636412
Peritoneal Neoplasms	Stimulate	9527324
Peritonitis	Stimulate	17094412, 18200665, 21089052
Peritonitis	Associate	21540863, 22808003, 23585849, 26873137
Perivascular Epithelioid Cell Neoplasms	Associate	21977985
Persistent Fetal Circulation Syndrome	Associate	34315444, 34678164
Personality Disorders	Associate	25824321
Pheochromocytoma	Associate	11605159, 23106811, 24675699, 25973039
Pheochromocytoma	Stimulate	12368197
Phyllodes Tumor	Associate	33342805, 37240386
Pigmentation Disorders	Associate	10873988
Pituitary Neoplasms	Associate	25027022, 28660986, 34620658, 35833823
Placenta Accreta	Stimulate	31322233
Placenta Diseases	Associate	34318873
Placenta Previa	Stimulate	36374543
Placenta Previa	Associate	37434137
Plaque Atherosclerotic	Associate	33536498, 9137092
Plasmablastic Lymphoma	Associate	16258629
Plasmacytoma	Associate	27605358
Platelet Glycoprotein IV Deficiency	Associate	40450010
Platelet Signal Processing Defect	Associate	36768728
Pleural Effusion	Associate	10804091, 18304793, 19414323, 25635424, 25818740, 29085180
Pleural Effusion	Stimulate	36769168, 36990774
Pleural Effusion Malignant	Associate	19414323
Pneumonia	Stimulate	22697069
Pneumonia Aspiration	Associate	12668796
POEMS Syndrome	Associate	12521215, 18497319
POEMS Syndrome	Stimulate	34744103
Poikiloderma with Neutropenia	Stimulate	16827115
Polycystic Ovary Syndrome	Associate	12759245, 17953946, 20430377, 25106940, 27766947, 27846231, 28300464, 29206944, 30935253, 31032699, 31327131, 33094626, 34148561, 34360981, 34480296, 35032287, 35766692, 35872929 View all (3 more)
Polycystic Ovary Syndrome	Stimulate	25141961, 27766947, 34646235, 7531945
Polycythemia Vera	Associate	24463275, 34206393
Polymyositis	Associate	18821695, 30142763
Polyneuropathies	Stimulate	34744103
Polypoidal Choroidal Vasculopathy	Associate	15148217, 27465105, 29184088, 29212537, 30844038
Polyps	Associate	19762561, 28347226
Polyps	Inhibit	33108070
Post Acute COVID 19 Syndrome	Associate	26769301, 37301958, 38259488, 39201353, 39615603
Postoperative Complications	Associate	22795057
Pre Eclampsia	Associate	10780661, 11943725, 16752232, 21575227, 23056578, 23083510, 23437230, 23725083, 25135655, 26010865, 29436641, 29940621, 30409050, 31477211, 31519209 View all (6 more)
Pre Eclampsia	Stimulate	14602804, 31154903, 37434137
Pre Eclampsia	Inhibit	22555639, 25341970, 27012926, 37950229
Precancerous Conditions	Stimulate	22558473, 26990868
Precancerous Conditions	Associate	25172294, 26457244, 31173290, 35313079
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	18694513
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	20510681, 35449729
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	10604739, 11380392, 12100142, 12915891, 17107349, 17983459, 20729179, 32678078, 9886308
Preeclamptic toxemia	Inhibit	22555639, 23725083
Preeclamptic toxemia	Associate	31154903
Pregnancy Complications	Associate	33405003
Premature Birth	Associate	17353160
Pressure Ulcer	Associate	26830973, 37746975
Primary Myelofibrosis	Associate	22081434, 25421114, 34206393, 34440447
Primary Ovarian Insufficiency	Stimulate	37710281
Proctitis	Associate	23737650
Prodromal Symptoms	Associate	10733773, 17963063
Prostate cancer familial	Associate	29095436
Prostatic Hyperplasia	Associate	15113042
Prostatic Neoplasms	Associate	11506499, 11571633, 12401798, 15274358, 15500293, 16491267, 16572586, 16638750, 16886625, 17127464, 17698375, 17908652, 18563715, 18615482, 19106642 View all (47 more)
Prostatic Neoplasms	Stimulate	22549243, 23679318
Prostatic Neoplasms Castration Resistant	Associate	31748715, 35782093, 37960958
Prostatic stromal proliferation of uncertain malignant potential	Associate	39261828
Prostatitis	Associate	11330643, 15113042, 15500293, 16054437, 27448695, 27759451, 35302608, 35761975, 36033830, 37232542, 8826857
Prostatitis	Stimulate	23831623
Prosthesis Failure	Associate	12968666
Proteinuria	Associate	15140761, 25047123, 26274923
Proteinuria	Stimulate	15610240
Proteinuria	Inhibit	19139726
Pseudoxanthoma Elasticum	Associate	25264593
Psoriasis	Stimulate	11348459, 24587411
Psoriasis	Associate	32411787, 33416099, 37531036, 7738351, 8064230, 8702976, 9539788
Psychological Distress	Associate	26654980
Psychotic Disorders	Associate	30310054
Pterygium	Associate	22219642, 28393179, 29392130, 31927552, 32753832
Pulmonary Arterial Hypertension	Associate	18355767, 28120560
Pulmonary Arterial Hypertension	Stimulate	20808962
Pulmonary Disease Chronic Obstructive	Stimulate	15681497, 30154415
Pulmonary Disease Chronic Obstructive	Associate	17136983, 17693481, 19165499, 19196819, 21306579, 23148928, 26251585, 26926362, 27163696, 28298222, 28865600, 28880936, 32158203, 34081380, 34946296
Pulmonary Disease Chronic Obstructive	Inhibit	21660298, 22172637, 26453303
Pulmonary Edema	Associate	11471568, 19327291
Pulmonary edema of mountaineers	Associate	19144048, 26436397, 36230894
Pulmonary Fibrosis	Associate	28128990, 37344825
Pulmonary Valve Insufficiency	Associate	30232381
Purpura Thrombocytopenic Idiopathic	Associate	26628061, 34326842
Pyoderma Gangrenosum	Stimulate	20636397, 21658319
Radiation Pneumonitis	Associate	22320189, 22541966, 34964782
Radicular Cyst	Associate	21308293, 26458594, 30382180
Rectal Neoplasms	Associate	11875737, 16222693, 16397240, 17016487, 18182986, 24265562, 24374863, 25423914, 31261557, 32331433
Recurrent respiratory papillomatosis	Associate	28757601, 38193541
Renal Insufficiency	Associate	18829023, 26305668, 34177897, 36901702
Renal Insufficiency Chronic	Associate	19917374, 20383146, 23594677, 24189015, 27367286, 31924810
Renal Insufficiency Chronic	Stimulate	32046176, 36591354
Respiratory Distress Syndrome	Associate	12653578, 15741444, 17289863, 19327291, 20228180, 25120850, 31982041
Respiratory Distress Syndrome	Inhibit	12668796, 35460699
Respiratory Insufficiency	Stimulate	21906274
Respiratory Insufficiency	Associate	26488115
Respiratory Sounds	Stimulate	25326706
Respiratory Tract Infections	Associate	27928450
Reticular dysgenesis	Associate	31558345
Retinal Detachment	Associate	29212537, 32823472
Retinal Diseases	Associate	23439602, 27783271, 32855870, 32945388, 33065984
Retinal Diseases	Inhibit	28257068
Retinal Drusen	Associate	32407518
Retinal Dysplasia	Associate	11978184, 12845630
Retinal Dysplasia	Stimulate	17566019
Retinal Hemorrhage	Associate	39260060
Retinal Neovascularization	Associate	15156160, 23213275
Retinal Vein Occlusion	Associate	20664492, 25978399, 27783271, 34967360, 35370941, 36220884
Retinitis	Associate	24558482, 8703862
Retinoblastoma	Associate	17442832, 20157412, 20860824, 22457763, 25337214, 26619025
Retinopathy of Prematurity	Stimulate	10751359
Retinopathy of Prematurity	Associate	11331770, 16735995, 25588190, 26365970, 27783271, 32728160, 33632168, 33811221, 37272765, 39260060, 40084286
Retinoschisis	Associate	28272453
Retroperitoneal Fibrosis	Associate	23690937
Rhabdomyosarcoma Alveolar	Associate	26553361
Rhabdomyosarcoma Embryonal	Associate	26553361
Rheumatic Diseases	Associate	15956138
Rheumatic Fever	Associate	11212152
Rhinitis Allergic	Associate	33626956
Rhinitis Allergic Seasonal	Associate	15627640
Ring Chromosome 20 Syndrome	Stimulate	28578351
Rotator Cuff Injuries	Associate	14554230
Rotator Cuff Injuries	Stimulate	20799939
Rufous oculocutaneous albinism	Associate	22990551
Rupture	Stimulate	22337942
Salivary Duct Calculi	Associate	23852769
Salivary Gland Neoplasms	Associate	17972532, 21948244, 23771070, 29521047
Sarcoidosis	Associate	11641969, 23181555
Sarcoidosis	Stimulate	20169144, 26445225
Sarcoidosis Pulmonary	Associate	20169144
Sarcoma	Associate	15015617, 16101185, 25973067, 27771610, 35069780, 38058118, 38086608
Sarcoma	Stimulate	24927770
Sarcoma Alveolar Soft Part	Associate	19146682, 32127467
Sarcoma Clear Cell	Associate	10705399
Sarcoma Ewing	Associate	22643796, 29263143, 33682749
Sarcoma Kaposi	Associate	10361120, 10640727, 15254407, 15542692, 15800227, 16861237, 19260835, 20660728, 21421336, 23936513, 26092770, 27208691, 31252633, 36890149, 8644848, 9621077 View all (1 more)
Sarcoma Synovial	Associate	29893303
Schwannomatosis	Associate	33025139
Scleroderma Systemic	Associate	24982919, 26584613, 39684939
Scleroderma Systemic	Stimulate	32085768
Seizures	Stimulate	22812626
Seizures	Associate	36820574
Sepsis	Associate	12653578, 19176759, 21371321, 25885541
Sepsis	Stimulate	15613012, 20213923
Sertoli Cell Only Syndrome	Associate	37647140
Severe Acute Respiratory Syndrome	Associate	20716170
Shock	Associate	21424068
Shock Hemorrhagic	Associate	21424068
Shock Septic	Associate	21371321
Shock Septic	Inhibit	21424068
Shoulder Impingement Syndrome	Associate	11398859
Shoulder Pain	Associate	11398859
Sick Sinus Syndrome	Associate	11300331, 11875737, 9376264
Simpson Golabi Behmel syndrome	Associate	25179090
Sinonasal undifferentiated carcinoma	Associate	23633104, 36946265
Sinus Thrombosis Intracranial	Stimulate	28951386
Sjogren's Syndrome	Stimulate	24772480
Sjogren's Syndrome	Inhibit	25636309
Sjogren's Syndrome	Associate	29558032, 35705251, 36999025
Skin Diseases	Associate	22413008
Skin Diseases	Stimulate	23166713, 9328154
Skin Manifestations	Associate	28343620, 35349405
Skin Neoplasms	Associate	23166713, 35886018
Sleep Apnea Obstructive	Stimulate	16085213
Sleep Apnea Obstructive	Associate	25541696, 27108420, 28514291, 29997451, 33737411, 36479843
Sleep Apnea Syndromes	Associate	15588038, 16085213
Sleep Wake Disorders	Stimulate	19926609
Small Cell Lung Carcinoma	Associate	11870537, 15330186, 18671849, 21718596, 26823791, 35641209
Smith McCort Dysplasia	Associate	20020816
Smoke Inhalation Injury	Stimulate	22558473, 32300208, 39777758
Smoke Inhalation Injury	Associate	28206971, 36091938
Smoldering Multiple Myeloma	Associate	24355943
Smooth Muscle Tumor	Inhibit	17944915
Soft Tissue Neoplasms	Associate	17201149
Solitary Pulmonary Nodule	Associate	19550130
Spastic paraplegia 11 autosomal recessive	Stimulate	9823778
Spinal Cord Injuries	Associate	28281545
Spinocerebellar Ataxia 11	Associate	19077470
Splenomegaly	Associate	18534064
Spondylitis Ankylosing	Associate	26125893, 33958655
Squamous Cell Carcinoma of Head and Neck	Associate	10023341, 10952783, 11050477, 15330158, 15475932, 16641910, 16827115, 18225538, 18283272, 18836279, 19300368, 20498643, 20546613, 21316013, 21595617 View all (38 more)
Squamous Cell Carcinoma of Head and Neck	Stimulate	19480853, 20702412, 24577893, 37322630, 39873996
Squamous Intraepithelial Lesions	Associate	27313335, 36482542
ST Elevation Myocardial Infarction	Associate	40247170
Stargardt Disease	Associate	34486473
Status Asthmaticus	Associate	20624651, 27579513, 30574871, 30740942, 31586488, 31831011, 37240226
Status Asthmaticus	Stimulate	22227417, 22689881, 26020772
Stevens Johnson Syndrome	Associate	26808056
Stomach Diseases	Associate	18273500
Stomach Diseases	Stimulate	23404437
Stomach Neoplasms	Associate	11978184, 12174362, 12439912, 12460468, 12509426, 12618892, 12647634, 12708473, 12854133, 12854174, 14666382, 14710231, 15029262, 15112337, 15112366 View all (92 more)
Stomach Neoplasms	Stimulate	23117246, 29228423, 38319150
Stomach Neoplasms	Inhibit	35069035, 37226719
Stomach Ulcer	Associate	15246970
Stroke	Associate	28234972, 32506171, 36820574, 39762845
Stroke	Stimulate	39969331
Subarachnoid Hemorrhage	Associate	29884860, 38173028
Sudden Unexpected Death in Epilepsy	Associate	22812626
Sweet Syndrome	Stimulate	20636397
Sweet Syndrome	Associate	21658319
Synovial Cyst	Stimulate	10971521
Synovial Cyst	Associate	11398859, 14554230, 26825024
Synovitis	Associate	20668498, 36598310
Systemic carnitine deficiency	Associate	29061162
Systemic Inflammatory Response Syndrome	Associate	33510953
Systemic Vasculitis	Associate	16546368
Tachycardia Atrioventricular Nodal Reentry	Stimulate	10733773
Tachycardia Atrioventricular Nodal Reentry	Associate	18629779
Takayasu Arteritis	Stimulate	31573481
Tang Hsi Ryu syndrome	Associate	20795427
Tarlov Cysts	Stimulate	20690417
Tarlov Cysts	Associate	35900477
Telangiectasia Hereditary Hemorrhagic	Associate	24587130, 25839219, 33894400, 35343049
Telangiectasia Hereditary Hemorrhagic	Stimulate	24667223, 33211216
Temporomandibular Joint Disorders	Associate	26239269
Tendinopathy	Stimulate	14554207
Tendinopathy	Associate	18459027, 22337942
Tertiary Lymphoid Structures	Associate	10952783, 12696078, 20003271, 20953377, 23059773, 27173353
Tertiary Lymphoid Structures	Stimulate	11376560, 12209728, 12647634, 9484827
Tetralogy of Fallot	Associate	26558525, 30232381, 34328347
Thalassemia	Associate	12111782, 23314673
Thromboangiitis Obliterans	Associate	9845647
Thrombocythemia Essential	Stimulate	24463275, 30781507
Thrombocytopenia Platelet Dysfunction Hemolysis and Imbalanced Globin Synthesis	Inhibit	25421114
Thrombophlebitis	Associate	30420902
Thrombosis	Associate	24294378, 27928450, 30781507
Thrombosis	Stimulate	32203583
Thrombotic Microangiopathies	Associate	16162193, 28183278
Thymic epithelial tumor	Associate	12202865, 24908332
Thymoma	Associate	12049674
Thymoma	Stimulate	27387303
Thymus Neoplasms	Associate	26254278
Thyroid Cancer Papillary	Associate	19255327, 24670538, 27925342, 28178662, 28425432, 29655286, 30678450, 31378898, 32151175, 32615729, 32824922, 33721460, 34781815, 34927541, 40430098
Thyroid Cancer Papillary	Inhibit	24884830
Thyroid Carcinoma Anaplastic	Associate	31183379, 31545405
Thyroid Neoplasms	Associate	10595926, 18596272, 20237991, 22548798, 22577338, 22641097, 22890443, 23771538, 24687553, 28178662, 32824922, 33721460, 35313079, 35813296, 36253663
Thyroid Neoplasms	Stimulate	29953504
Thyroid Nodule	Stimulate	10888784
Thyroid Nodule	Associate	25729930, 36253663
Thyroiditis	Associate	17696908
Thyroiditis Autoimmune	Associate	15311211, 26955881, 27494076
Tibial Meniscus Injuries	Associate	28318650
Tics	Associate	36820574
Tissue Adhesions	Associate	23826415
Tn Syndrome	Associate	35628426
Tongue Diseases	Associate	22466894
Tongue Neoplasms	Associate	23155356
Toxoplasmosis Ocular	Associate	32432052
Trigeminal Neuralgia	Inhibit	34067581
Triple Negative Breast Neoplasms	Associate	11556826, 23340303, 23667446, 25356777, 25824321, 27484639, 29049198, 29936177, 31059004, 31235595, 32406563, 33219203, 34791795, 35710947, 37389973, 37657065, 37713894, 38169627 View all (3 more)
Triple Negative Breast Neoplasms	Stimulate	19549711, 35268073
Tuberculosis	Associate	11972637
Tuberculosis	Inhibit	22606304
Tuberculosis	Stimulate	24327799
Tuberculosis Meningeal	Stimulate	11972637, 32823472
Ulcer	Stimulate	15531204, 37365645
Ulcer	Associate	15988806, 24618232
Unconsciousness	Associate	36820574
Uremia	Associate	34858433
Ureteral Obstruction	Associate	23690937
Urethral Neoplasms	Associate	35203290, 36581931
Urinary Bladder Neck Obstruction	Stimulate	25951999
Urinary Bladder Neoplasms	Associate	10638984, 11953885, 11980898, 17319747, 18930813, 19190164, 19682434, 19692168, 20571940, 22558473, 23613251, 24448324, 25387487, 26193287, 26798188 View all (14 more)
Urinary Bladder Neoplasms	Stimulate	22895562
Urologic Neoplasms	Associate	26397152
Uterine Cervical Dysplasia	Stimulate	19479977
Uterine Cervical Dysplasia	Associate	21543926, 23098453, 25536602, 9400935
Uterine Cervical Neoplasms	Associate	10360662, 10944602, 15483346, 17505511, 18629779, 18847499, 19352388, 19574782, 21213129, 21424032, 21546870, 21792010, 23861821, 23873179, 24782650 View all (21 more)
Uterine Cervical Neoplasms	Stimulate	17678892
Uterine Cervical Neoplasms	Inhibit	25855930
Uterine Diseases	Associate	24260517, 26769301
Uterine Diseases	Inhibit	24471989
Uterine Diseases	Stimulate	26586929
Uveal melanoma	Associate	10873988, 11914215, 20036848, 27476775, 31765784
Uveitis	Stimulate	33639877, 35061677
Varicocele	Stimulate	18054935
Varicocele	Associate	36372090
Varicose Ulcer	Stimulate	9737465
Varicose Veins	Associate	14760594, 30498761
Varicose Veins	Stimulate	32594304
Vascular Diseases	Associate	10780661, 24316428, 28300464, 28918499, 30719863, 30871567, 32879419, 33499313, 33515594, 34565088, 34858433, 9665461
Vascular Diseases	Inhibit	22555639, 27612459
Vascular Remodeling	Associate	10212108, 28399937
Vascular Ring	Associate	35712246
Vascular System Injuries	Associate	20808962, 26768002, 30420902, 37415174, 37903435
Vasculitis	Associate	16546368
Vasculitis Leukocytoclastic Cutaneous	Associate	26429157
Vasospasm Intracranial	Associate	29884860
Venous Insufficiency	Stimulate	31886225
Venous Thromboembolism	Associate	27481876, 32851067
Venous Thrombosis	Associate	23690937, 34440447
Venular Insufficiency Systemic	Associate	28775055
Vesico Ureteral Reflux	Associate	22558067
Virus Diseases	Associate	21880131, 25899133
Vision Disorders	Inhibit	33172148, 34721402
Vision Low	Associate	37079518
Vitamin D Deficiency	Associate	35213796
Vitelliform Macular Dystrophy	Associate	30498755
Vitelliform Macular Dystrophy	Stimulate	34794403
Vitreoretinopathy Proliferative	Associate	24227910, 28572674, 31700227, 9486038
Vitreous Hemorrhage	Associate	17522146, 29263305
Vitreous Hemorrhage	Inhibit	34566400
Vocal Cord Paralysis	Associate	35513993
von Hippel Lindau Disease	Associate	12115316, 23106811, 9402176
von Hippel Lindau Disease	Stimulate	12912922, 16627979
von Hippel Lindau Disease	Inhibit	22086907, 9346879, 9665461
Weight Loss	Inhibit	23401397
White Dot Syndromes	Associate	31700227
Wieacker syndrome	Stimulate	27070589
Wieacker syndrome	Associate	34560403
Wilms Tumor	Associate	12560388, 21594709
Wounds and Injuries	Associate	19944696, 30372878, 37573538, 7615975
Wounds and Injuries	Stimulate	26274923, 26564985, 30581533
X Linked Combined Immunodeficiency Diseases	Associate	23998120
Zinc Deficiency Neonatal due to Low Breast Milk Zinc	Stimulate	18615482

VEGFA (vascular endothelial growth factor A)