Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7378
Gene name Gene Name - the full gene name approved by the HGNC.	Uridine phosphorylase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	UPP1
Synonyms (NCBI Gene) Gene synonyms aliases	UDRPASE, UP, UPASE, UPP
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7p12.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a uridine phosphorylase, an enzyme that catalyzes the reversible phosphorylation of uridine (or 2`- deoxyuridine) to uracil and ribose-1-phosphate (or deoxyribose-1-phosphate). The encoded enzyme functions in the degradation and salvage

Show/Hide all(23)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024540	hsa-miR-215-5p	Microarray	19074876
MIRT026152	hsa-miR-192-5p	Microarray	19074876
MIRT1921023	hsa-miR-214	CLIP-seq
MIRT1921024	hsa-miR-31	CLIP-seq
MIRT1921025	hsa-miR-3619-5p	CLIP-seq
MIRT1921026	hsa-miR-4527	CLIP-seq
MIRT1921027	hsa-miR-761	CLIP-seq
MIRT1921023	hsa-miR-214	CLIP-seq
MIRT1921024	hsa-miR-31	CLIP-seq
MIRT1921025	hsa-miR-3619-5p	CLIP-seq
MIRT1921026	hsa-miR-4527	CLIP-seq
MIRT1921027	hsa-miR-761	CLIP-seq
MIRT1921023	hsa-miR-214	CLIP-seq
MIRT1921024	hsa-miR-31	CLIP-seq
MIRT1921025	hsa-miR-3619-5p	CLIP-seq
MIRT1921026	hsa-miR-4527	CLIP-seq
MIRT1921027	hsa-miR-761	CLIP-seq
MIRT1921023	hsa-miR-214	CLIP-seq
MIRT1921024	hsa-miR-31	CLIP-seq
MIRT1921025	hsa-miR-3619-5p	CLIP-seq
MIRT1921026	hsa-miR-4527	CLIP-seq
MIRT1921027	hsa-miR-761	CLIP-seq
MIRT2363723	hsa-miR-578	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
NFKB1	Activation	20544543
RELA	Activation	20544543
STAT1	Activation	20544543

Show/Hide all(30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003824	Function	Catalytic activity	IEA
GO:0004850	Function	Uridine phosphorylase activity	IBA
GO:0004850	Function	Uridine phosphorylase activity	IDA	7488099
GO:0004850	Function	Uridine phosphorylase activity	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006139	Process	Nucleobase-containing compound metabolic process	TAS	7488099
GO:0006218	Process	Uridine catabolic process	IBA
GO:0006218	Process	Uridine catabolic process	IDA	7488099
GO:0006218	Process	Uridine catabolic process	IEA
GO:0006220	Process	Pyrimidine nucleotide metabolic process	IEA
GO:0006248	Process	CMP catabolic process	IEA
GO:0006249	Process	DCMP catabolic process	IEA
GO:0009032	Function	Thymidine phosphorylase activity	IEA
GO:0009116	Process	Nucleoside metabolic process	IEA
GO:0009166	Process	Nucleotide catabolic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0016763	Function	Pentosyltransferase activity	IEA
GO:0042149	Process	Cellular response to glucose starvation	IEA
GO:0042802	Function	Identical protein binding	IPI	19291308, 20856879
GO:0044206	Process	UMP salvage	IEA
GO:0046050	Process	UMP catabolic process	IEA
GO:0046074	Process	DTMP catabolic process	IEA
GO:0046079	Process	DUMP catabolic process	IEA
GO:0046108	Process	Uridine metabolic process	IEA
GO:0047847	Function	Deoxyuridine phosphorylase activity	IEA

MIM	HGNC	e!Ensembl
191730	12576	ENSG00000183696

Protein

UniProt ID

Q16831

Protein name

Uridine phosphorylase 1 (UPase 1) (UrdPase 1) (EC 2.4.2.3)

Protein function

Catalyzes the reversible phosphorylytic cleavage of uridine to uracil and ribose-1-phosphate which can then be utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis (PubMed:7488099). Shows broad subs

PDB

3EUE , 3EUF , 3NBQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01048	PNP_UDP_1	54 → 304	Phosphorylase superfamily	Domain

Sequence

MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGG
SPSRMKAFIRCVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLH
ELIKLLYYARCSNVTIIRIGTSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKT
DLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAY
AAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVS
YFIKKKLSKA

Sequence length

310

Interactions

View interactions

	KEGG		Reactome
	Pyrimidine metabolism Drug metabolism - other enzymes Metabolic pathways Nucleotide metabolism		Pyrimidine salvage Pyrimidine catabolism

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Long QT Syndrome	long qt syndrome	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (26)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Autism Spectrum Disorder	Associate	23275889
Breast Neoplasms	Associate	31496029
Carcinoma Transitional Cell	Associate	9818021
Colorectal Neoplasms	Associate	35354355
Communicable Diseases	Associate	38310908
Cystitis Interstitial	Associate	32377607
Depressive Disorder Major	Associate	28688579
Esophageal Squamous Cell Carcinoma	Associate	36290884
Fibrosis	Associate	32235494
Glioblastoma	Stimulate	40348204
Glioma	Associate	32583596, 33498463
Glioma of Brain Familial	Associate	32583596
Inflammation	Associate	32583596
Intervertebral Disc Degeneration	Associate	35409356
Lymphatic Metastasis	Inhibit	17707461
Lymphatic Metastasis	Stimulate	31496029
Neoplasm Invasiveness	Inhibit	17707461
Neoplasms	Associate	11401323, 15714138, 17264243, 32583596, 34498424, 34974792
Neoplasms	Inhibit	29382334
Neoplasms	Stimulate	31496029
Pancreatic Neoplasms	Associate	15714138
Stomach Neoplasms	Associate	17214321
Thyroid Neoplasms	Associate	31496029
Ulcer	Associate	32377607
Urinary Bladder Neoplasms	Inhibit	17707461
Uterine Cervical Neoplasms	Associate	34498424

UPP1 (uridine phosphorylase 1)