Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7376
Gene name Gene Name - the full gene name approved by the HGNC.	Nuclear receptor subfamily 1 group H member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NR1H2
Synonyms (NCBI Gene) Gene synonyms aliases	LXR-b, LXRB, NER, NER-I, RIP15, UNR
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.33
Summary Summary of gene provided in NCBI Entrez Gene.	The liver X receptors, LXRA (NR1H3; MIM 602423) and LXRB, form a subfamily of the nuclear receptor superfamily and are key regulators of macrophage function, controlling transcriptional programs involved in lipid homeostasis and inflammation. The inducibl

Show/Hide all(55)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025788	hsa-miR-7-5p	Microarray	17612493
MIRT040136	hsa-miR-615-3p	CLASH	23622248
MIRT724633	hsa-miR-1292-3p	HITS-CLIP	19536157
MIRT724632	hsa-miR-136-5p	HITS-CLIP	19536157
MIRT724633	hsa-miR-1292-3p	HITS-CLIP	19536157
MIRT724632	hsa-miR-136-5p	HITS-CLIP	19536157
MIRT1192133	hsa-miR-1237	CLIP-seq
MIRT1192134	hsa-miR-1299	CLIP-seq
MIRT1192135	hsa-miR-18a	CLIP-seq
MIRT1192136	hsa-miR-18b	CLIP-seq
MIRT1192137	hsa-miR-3127-3p	CLIP-seq
MIRT1192138	hsa-miR-3649	CLIP-seq
MIRT1192139	hsa-miR-4432	CLIP-seq
MIRT1192140	hsa-miR-4520a-5p	CLIP-seq
MIRT1192141	hsa-miR-4520b-5p	CLIP-seq
MIRT1192142	hsa-miR-4735-3p	CLIP-seq
MIRT1192143	hsa-miR-4761-5p	CLIP-seq
MIRT1192144	hsa-miR-4772-3p	CLIP-seq
MIRT1192145	hsa-miR-4782-5p	CLIP-seq
MIRT1192146	hsa-miR-492	CLIP-seq
MIRT1192147	hsa-miR-5096	CLIP-seq
MIRT1192148	hsa-miR-516b	CLIP-seq
MIRT1192149	hsa-miR-7	CLIP-seq
MIRT1192150	hsa-miR-720	CLIP-seq
MIRT1192151	hsa-miR-875-3p	CLIP-seq
MIRT1556742	hsa-miR-3690	CLIP-seq
MIRT1192135	hsa-miR-18a	CLIP-seq
MIRT1192136	hsa-miR-18b	CLIP-seq
MIRT2284550	hsa-miR-296-5p	CLIP-seq
MIRT2284551	hsa-miR-3125	CLIP-seq
MIRT1192137	hsa-miR-3127-3p	CLIP-seq
MIRT2284552	hsa-miR-3179	CLIP-seq
MIRT2284553	hsa-miR-342-5p	CLIP-seq
MIRT2284554	hsa-miR-3916	CLIP-seq
MIRT2284555	hsa-miR-3918	CLIP-seq
MIRT2284556	hsa-miR-3936	CLIP-seq
MIRT2284557	hsa-miR-4476	CLIP-seq
MIRT1192140	hsa-miR-4520a-5p	CLIP-seq
MIRT1192141	hsa-miR-4520b-5p	CLIP-seq
MIRT2284558	hsa-miR-4664-5p	CLIP-seq
MIRT2284559	hsa-miR-4685-5p	CLIP-seq
MIRT2284560	hsa-miR-4686	CLIP-seq
MIRT1192142	hsa-miR-4735-3p	CLIP-seq
MIRT1192143	hsa-miR-4761-5p	CLIP-seq
MIRT2284561	hsa-miR-939	CLIP-seq
MIRT1192137	hsa-miR-3127-3p	CLIP-seq
MIRT1192138	hsa-miR-3649	CLIP-seq
MIRT1192144	hsa-miR-4772-3p	CLIP-seq
MIRT1192146	hsa-miR-492	CLIP-seq
MIRT1192147	hsa-miR-5096	CLIP-seq
MIRT1192137	hsa-miR-3127-3p	CLIP-seq
MIRT1192138	hsa-miR-3649	CLIP-seq
MIRT1192144	hsa-miR-4772-3p	CLIP-seq
MIRT1192146	hsa-miR-492	CLIP-seq
MIRT1192147	hsa-miR-5096	CLIP-seq

Show/Hide all(45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA	21873635
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	9013544
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	9013544
GO:0003677	Function	DNA binding	TAS	7926814
GO:0004879	Function	Nuclear receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	12393874, 16189514, 19060904, 21331046, 21900206, 23931754, 25661920, 26120082, 28514442, 31515488
GO:0005634	Component	Nucleus	IDA	12393874
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	12393874
GO:0006367	Process	Transcription initiation from RNA polymerase II promoter	TAS
GO:0008270	Function	Zinc ion binding	IEA
GO:0010745	Process	Negative regulation of macrophage derived foam cell differentiation	IC	17693624
GO:0010867	Process	Positive regulation of triglyceride biosynthetic process	IMP	17186944
GO:0010875	Process	Positive regulation of cholesterol efflux	IMP	17186944
GO:0010884	Process	Positive regulation of lipid storage	IEA
GO:0010887	Process	Negative regulation of cholesterol storage	IMP	17693624
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0031667	Process	Response to nutrient levels	IEA
GO:0032270	Process	Positive regulation of cellular protein metabolic process	IMP	17186944
GO:0032369	Process	Negative regulation of lipid transport	IMP	17693624
GO:0032376	Process	Positive regulation of cholesterol transport	IDA	16141411
GO:0034191	Function	Apolipoprotein A-I receptor binding	IPI	23931754
GO:0036151	Process	Phosphatidylcholine acyl-chain remodeling	ISS
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0045723	Process	Positive regulation of fatty acid biosynthetic process	IMP	17186944
GO:0045861	Process	Negative regulation of proteolysis	IEA
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	12393874
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	25661920
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9013544, 16141411, 20219900
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	17186944
GO:0046965	Function	Retinoid X receptor binding	IEA
GO:0048384	Process	Retinoic acid receptor signaling pathway	IEA
GO:0048550	Process	Negative regulation of pinocytosis	IMP	17693624
GO:0051006	Process	Positive regulation of lipoprotein lipase activity	IMP	17186944
GO:0051117	Function	ATPase binding	IPI	23931754
GO:0060336	Process	Negative regulation of interferon-gamma-mediated signaling pathway	NAS	21268089
GO:0090108	Process	Positive regulation of high-density lipoprotein particle assembly	IEA
GO:0090187	Process	Positive regulation of pancreatic juice secretion	IEA
GO:0090340	Process	Positive regulation of secretion of lysosomal enzymes	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	21173252
GO:1903573	Process	Negative regulation of response to endoplasmic reticulum stress	ISS

MIM	HGNC	e!Ensembl
600380	7965	ENSG00000131408

Protein

UniProt ID

P55055

Protein name

Oxysterols receptor LXR-beta (Liver X receptor beta) (Nuclear receptor NER) (Nuclear receptor subfamily 1 group H member 2) (Ubiquitously-expressed nuclear receptor)

Protein function

Nuclear receptor that exhibits a ligand-dependent transcriptional activation activity (PubMed:25661920). Binds preferentially to double-stranded oligonucleotide direct repeats having the consensus half-site sequence 5'-AGGTCA-3' and 4-nt spacing

PDB

1P8D , 1PQ6 , 1PQ9 , 1PQC , 1UPV , 1UPW , 3KFC , 3L0E , 4DK7 , 4DK8 , 4NQA , 4RAK , 5HJP , 5I4V , 5JY3 , 5KYA , 5KYJ , 6JIO , 6K9G , 6K9H , 6K9M , 6S4N , 6S4T , 6S4U , 6S5K

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00105	zf-C4	85 → 156	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	256 → 444	Ligand-binding domain of nuclear hormone receptor	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDW
VIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA
RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQ
SQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKR
SFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQI
ALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMR
RLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRM
LMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE

Sequence length

460

Interactions

View interactions

	KEGG		Reactome
	Efferocytosis Insulin resistance		PPARA activates gene expression Nuclear Receptor transcription pathway SUMOylation of intracellular receptors VLDLR internalisation and degradation NR1H2 & NR1H3 regulate gene expression linked to lipogenesis NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux NR1H2 & NR1H3 regulate gene expression to limit cholesterol uptake NR1H2 & NR1H3 regulate gene expression linked to triglyceride lipolysis in adipose NR1H2 & NR1H3 regulate gene expression to control bile acid homeostasis

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Cholestasis	Cholestasis	rs121909103, rs751511532, rs376368459, rs762702807, rs1578490102, rs1578499691, rs1578504946, rs1317656688, rs199791850, rs1452792080, rs1578491039	17256725

Show/Hide Text Mining Associations (33)

Disease Name	Relationship Type	References
Associations from Text Mining
Anxiety	Associate	28099631
Ascites	Associate	30526541
Atherosclerosis	Associate	23717417
Bladder Exstrophy	Associate	37509153
Breast Neoplasms	Associate	32075687, 37059993
Carcinogenesis	Associate	23838803
Colitis Ulcerative	Associate	21245992
Colorectal Neoplasms	Associate	20836841, 26450852, 33294438
Dementia Vascular	Associate	31932555
Diabetes Mellitus Type 2	Associate	19292929, 20939869
Drug Related Side Effects and Adverse Reactions	Associate	26450852
Endometrial Neoplasms	Associate	29371332
Gallbladder Neoplasms	Associate	23838803, 24863943
Gallstones	Associate	23838803
Glioblastoma	Associate	31664073
Glucose Intolerance	Associate	20939869
Hemolytic Uremic Syndrome	Inhibit	40108621
Hyperlipoproteinemia Type II	Associate	33028190
Inflammation	Associate	20939869, 23185273
Inflammatory Bowel Diseases	Associate	21245992
Lupus Erythematosus Systemic	Stimulate	24463447
Neoplasms	Associate	26450852, 27356755, 32075687, 36063487, 37059993
Obesity	Associate	20939869
Osteoarthritis	Associate	19217805
Ovarian Neoplasms	Associate	30526541
Overweight	Associate	20939869
Parkinson Disease	Associate	21951066
Plaque Atherosclerotic	Associate	24036496
Thyroid Cancer Papillary	Associate	32814418
Thyroid Neoplasms	Associate	32814418
Triple Negative Breast Neoplasms	Associate	31432185
Tuberculosis	Inhibit	24788534
Tuberculosis	Associate	24788534

NR1H2 (nuclear receptor subfamily 1 group H member 2)