Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	7376
Gene name	Nuclear receptor subfamily 1 group H member 2
Gene symbol	NR1H2
Synonyms (NCBI Gene)	LXR-bLXRBNERNER-IRIP15UNR
Chromosome	19
Chromosome location	19q13.33
Summary	The liver X receptors, LXRA (NR1H3; MIM 602423) and LXRB, form a subfamily of the nuclear receptor superfamily and are key regulators of macrophage function, controlling transcriptional programs involved in lipid homeostasis and inflammation. The inducibl

Show/Hide all (55)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025788	hsa-miR-7-5p	Microarray	17612493
MIRT040136	hsa-miR-615-3p	CLASH	23622248
MIRT724633	hsa-miR-1292-3p	HITS-CLIP	19536157
MIRT724632	hsa-miR-136-5p	HITS-CLIP	19536157
MIRT724633	hsa-miR-1292-3p	HITS-CLIP	19536157
MIRT724632	hsa-miR-136-5p	HITS-CLIP	19536157
MIRT1192133	hsa-miR-1237	CLIP-seq
MIRT1192134	hsa-miR-1299	CLIP-seq
MIRT1192135	hsa-miR-18a	CLIP-seq
MIRT1192136	hsa-miR-18b	CLIP-seq
MIRT1192137	hsa-miR-3127-3p	CLIP-seq
MIRT1192138	hsa-miR-3649	CLIP-seq
MIRT1192139	hsa-miR-4432	CLIP-seq
MIRT1192140	hsa-miR-4520a-5p	CLIP-seq
MIRT1192141	hsa-miR-4520b-5p	CLIP-seq
MIRT1192142	hsa-miR-4735-3p	CLIP-seq
MIRT1192143	hsa-miR-4761-5p	CLIP-seq
MIRT1192144	hsa-miR-4772-3p	CLIP-seq
MIRT1192145	hsa-miR-4782-5p	CLIP-seq
MIRT1192146	hsa-miR-492	CLIP-seq
MIRT1192147	hsa-miR-5096	CLIP-seq
MIRT1192148	hsa-miR-516b	CLIP-seq
MIRT1192149	hsa-miR-7	CLIP-seq
MIRT1192150	hsa-miR-720	CLIP-seq
MIRT1192151	hsa-miR-875-3p	CLIP-seq
MIRT1556742	hsa-miR-3690	CLIP-seq
MIRT1192135	hsa-miR-18a	CLIP-seq
MIRT1192136	hsa-miR-18b	CLIP-seq
MIRT2284550	hsa-miR-296-5p	CLIP-seq
MIRT2284551	hsa-miR-3125	CLIP-seq
MIRT1192137	hsa-miR-3127-3p	CLIP-seq
MIRT2284552	hsa-miR-3179	CLIP-seq
MIRT2284553	hsa-miR-342-5p	CLIP-seq
MIRT2284554	hsa-miR-3916	CLIP-seq
MIRT2284555	hsa-miR-3918	CLIP-seq
MIRT2284556	hsa-miR-3936	CLIP-seq
MIRT2284557	hsa-miR-4476	CLIP-seq
MIRT1192140	hsa-miR-4520a-5p	CLIP-seq
MIRT1192141	hsa-miR-4520b-5p	CLIP-seq
MIRT2284558	hsa-miR-4664-5p	CLIP-seq
MIRT2284559	hsa-miR-4685-5p	CLIP-seq
MIRT2284560	hsa-miR-4686	CLIP-seq
MIRT1192142	hsa-miR-4735-3p	CLIP-seq
MIRT1192143	hsa-miR-4761-5p	CLIP-seq
MIRT2284561	hsa-miR-939	CLIP-seq
MIRT1192137	hsa-miR-3127-3p	CLIP-seq
MIRT1192138	hsa-miR-3649	CLIP-seq
MIRT1192144	hsa-miR-4772-3p	CLIP-seq
MIRT1192146	hsa-miR-492	CLIP-seq
MIRT1192147	hsa-miR-5096	CLIP-seq
MIRT1192137	hsa-miR-3127-3p	CLIP-seq
MIRT1192138	hsa-miR-3649	CLIP-seq
MIRT1192144	hsa-miR-4772-3p	CLIP-seq
MIRT1192146	hsa-miR-492	CLIP-seq
MIRT1192147	hsa-miR-5096	CLIP-seq

Show/Hide all (93)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	9013544
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	9013544
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	7926814
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	IEA
GO:0004879	Function	Nuclear receptor activity	TAS	7926814
GO:0005515	Function	Protein binding	IPI	12393874, 15722453, 16189514, 19060904, 20211142, 21331046, 21900206, 24561505, 25661920, 26120082, 28514442, 31515488, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12393874
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	12393874
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0009755	Process	Hormone-mediated signaling pathway	ISS
GO:0009755	Process	Hormone-mediated signaling pathway	NAS	27011007
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010745	Process	Negative regulation of macrophage derived foam cell differentiation	IC	17693624
GO:0010745	Process	Negative regulation of macrophage derived foam cell differentiation	IEA
GO:0010867	Process	Positive regulation of triglyceride biosynthetic process	IEA
GO:0010867	Process	Positive regulation of triglyceride biosynthetic process	IMP	17186944
GO:0010875	Process	Positive regulation of cholesterol efflux	IBA
GO:0010875	Process	Positive regulation of cholesterol efflux	IEA
GO:0010875	Process	Positive regulation of cholesterol efflux	IMP	17186944
GO:0010883	Process	Regulation of lipid storage	IBA
GO:0010884	Process	Positive regulation of lipid storage	IEA
GO:0010887	Process	Negative regulation of cholesterol storage	IEA
GO:0010887	Process	Negative regulation of cholesterol storage	IMP	17693624
GO:0030154	Process	Cell differentiation	IBA
GO:0030522	Process	Intracellular receptor signaling pathway	IBA
GO:0031490	Function	Chromatin DNA binding	IEA
GO:0031667	Process	Response to nutrient levels	IEA
GO:0032369	Process	Negative regulation of lipid transport	IEA
GO:0032369	Process	Negative regulation of lipid transport	IMP	17693624
GO:0032376	Process	Positive regulation of cholesterol transport	IDA	16141411
GO:0034191	Function	Apolipoprotein A-I receptor binding	IPI	23931754
GO:0036151	Process	Phosphatidylcholine acyl-chain remodeling	IEA
GO:0036151	Process	Phosphatidylcholine acyl-chain remodeling	ISS
GO:0042632	Process	Cholesterol homeostasis	IBA
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0042789	Process	MRNA transcription by RNA polymerase II	ISS
GO:0042789	Process	MRNA transcription by RNA polymerase II	NAS	27011007
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045723	Process	Positive regulation of fatty acid biosynthetic process	IEA
GO:0045723	Process	Positive regulation of fatty acid biosynthetic process	IMP	17186944
GO:0045861	Process	Negative regulation of proteolysis	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	12393874
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	25661920
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9013544, 16141411, 20219900
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	17186944
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	27011007
GO:0046872	Function	Metal ion binding	IEA
GO:0046965	Function	Nuclear retinoid X receptor binding	IEA
GO:0048384	Process	Retinoic acid receptor signaling pathway	IEA
GO:0048550	Process	Negative regulation of pinocytosis	IEA
GO:0048550	Process	Negative regulation of pinocytosis	IMP	17693624
GO:0050728	Process	Negative regulation of inflammatory response	IBA
GO:0051117	Function	ATPase binding	IPI	23931754
GO:0055088	Process	Lipid homeostasis	IEA
GO:0060336	Process	Negative regulation of type II interferon-mediated signaling pathway	NAS	21268089
GO:0090108	Process	Positive regulation of high-density lipoprotein particle assembly	IEA
GO:0090187	Process	Positive regulation of pancreatic juice secretion	IEA
GO:0090340	Process	Positive regulation of secretion of lysosomal enzymes	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	27011007
GO:0090575	Component	RNA polymerase II transcription regulator complex	ISS
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	21173252
GO:1902895	Process	Positive regulation of miRNA transcription	IEA
GO:1903573	Process	Negative regulation of response to endoplasmic reticulum stress	IEA
GO:1903573	Process	Negative regulation of response to endoplasmic reticulum stress	ISS

MIM	HGNC	e!Ensembl
600380	7965	ENSG00000131408

P55055

Protein name

Oxysterols receptor LXR-beta (Liver X receptor beta) (Nuclear receptor NER) (Nuclear receptor subfamily 1 group H member 2) (Ubiquitously-expressed nuclear receptor)

Protein function

Nuclear receptor that exhibits a ligand-dependent transcriptional activation activity (PubMed:25661920). Binds preferentially to double-stranded oligonucleotide direct repeats having the consensus half-site sequence 5'-AGGTCA-3' and 4-nt spacing

PDB

1P8D , 1PQ6 , 1PQ9 , 1PQC , 1UPV , 1UPW , 3KFC , 3L0E , 4DK7 , 4DK8 , 4NQA , 4RAK , 5HJP , 5I4V , 5JY3 , 5KYA , 5KYJ , 6JIO , 6K9G , 6K9H , 6K9M , 6S4N , 6S4T , 6S4U , 6S5K

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00105	zf-C4	85 → 156	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	256 → 444	Ligand-binding domain of nuclear hormone receptor	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDW
VIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA
RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQ
SQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKR
SFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQI
ALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMR
RLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRM
LMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE

Sequence length

460

Interactions

View interactions

	KEGG		Reactome
	Efferocytosis Insulin resistance		PPARA activates gene expression Nuclear Receptor transcription pathway SUMOylation of intracellular receptors VLDLR internalisation and degradation NR1H2 & NR1H3 regulate gene expression linked to lipogenesis NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux NR1H2 & NR1H3 regulate gene expression to limit cholesterol uptake NR1H2 & NR1H3 regulate gene expression linked to triglyceride lipolysis in adipose NR1H2 & NR1H3 regulate gene expression to control bile acid homeostasis

NR1H2 (nuclear receptor subfamily 1 group H member 2)