Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7366
Gene name Gene Name - the full gene name approved by the HGNC.	UDP glucuronosyltransferase family 2 member B15
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	UGT2B15
Synonyms (NCBI Gene) Gene synonyms aliases	HLUG4, UDPGT 2B8, UDPGT2B15, UDPGTH3, UGT2B8
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q13.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a glycosyltransferase that is invovled in the metabolism and elimination of toxic compounts, both endogenous and of xenobiotic origin. This gene plays a role in the regulation of estrogens and androgens. This locus is present in a cluste

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1902023	A>C	Drug-response	Coding sequence variant, missense variant

Show/Hide all(7)

miRTarBase ID	miRNA	Experiments
MIRT1473629	hsa-miR-133a	CLIP-seq
MIRT1473630	hsa-miR-133b	CLIP-seq
MIRT1473631	hsa-miR-3119	CLIP-seq
MIRT1473632	hsa-miR-3155	CLIP-seq
MIRT1473633	hsa-miR-3155b	CLIP-seq
MIRT1473634	hsa-miR-4436b-5p	CLIP-seq
MIRT1473635	hsa-miR-484	CLIP-seq

Transcription factors

Show/Hide all(7)

Transcription factor	Regulation	Reference
AR	Unknown	18302198
CDX2	Unknown	20070244
ESR1	Activation	19487245
FOSL2	Activation	19487245
FOXA1	Unknown	20736324
JUN	Activation	19487245
SP1	Unknown	20070244

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001972	Function	Retinoic acid binding	IDA	20308471
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	IDA	20056724
GO:0006805	Process	Xenobiotic metabolic process	TAS	7835232
GO:0008194	Function	UDP-glycosyltransferase activity	IEA
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008202	Process	Steroid metabolic process	TAS	7835232
GO:0008210	Process	Estrogen metabolic process	IBA
GO:0008210	Process	Estrogen metabolic process	IDA	18719240
GO:0015020	Function	Glucuronosyltransferase activity	IBA
GO:0015020	Function	Glucuronosyltransferase activity	IDA	18719240, 20056724, 22579593
GO:0015020	Function	Glucuronosyltransferase activity	IEA
GO:0015020	Function	Glucuronosyltransferase activity	TAS
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA

MIM	HGNC	e!Ensembl
600069	12546	ENSG00000196620

Protein

UniProt ID

P54855

Protein name

UDP-glucuronosyltransferase 2B15 (UDPGT 2B15) (UGT2B15) (EC 2.4.1.17) (HLUG4) (UDP-glucuronosyltransferase 2B8) (UDPGT 2B8) (UDPGTh-3)

Protein function

UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either th

PDB

6IPB , 7CJX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00201	UDPGT	24 → 527	UDP-glucoronosyl and UDP-glucosyl transferase	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in many tissues. Present in liver, prostate and testis. {ECO:0000269|PubMed:8399210}.

Sequence

MSLKWTSVFLLIQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSA
STLVNASKSSAIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEY
YDYSNKLCKDAVLNKKLMMKLQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYT
FEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIHMLYFDFWFQIYDLKKWDQFYSEV
LGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSS
GENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQ
NDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRT
MSSRDLLNALKSVINDPVYKENVMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVA
AHNLTWIQYHSLDVIAFLLACVATVIFIITKFCLFCFRKLAKKGKKKKRD

Sequence length

530

Interactions

View interactions

	KEGG		Reactome
	Pentose and glucuronate interconversions Ascorbate and aldarate metabolism Steroid hormone biosynthesis Retinol metabolism Porphyrin metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Biosynthesis of cofactors Bile secretion Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation		Glucuronidation

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Glioblastoma	Glioblastoma	N/A	N/A	GWAS
Hypogonadism	Hypogonadism	N/A	N/A	GWAS

Show/Hide Text Mining Associations (17)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Breast Neoplasms	Associate	15318931, 15952058, 21750172, 23951298, 33503040
Carcinoma Hepatocellular	Associate	32148377, 37181805, 37181808
Cardiotoxicity	Associate	38547766
Colorectal Neoplasms	Associate	24677636, 24822274
Lown Ganong Levine Syndrome	Associate	15318931
Melanoma	Associate	23110092
Melanosis	Associate	26238215
Mouth Neoplasms	Associate	28901451
Neoplasms	Associate	15318931, 28901451
Neoplasms	Stimulate	23110092, 27307252
Polycystic Ovary Syndrome	Inhibit	32176075
Prostatic Neoplasms	Associate	17848572, 23098242, 24267955, 28673330, 32660355
Prostatic Neoplasms Castration Resistant	Stimulate	21365123
Prostatitis	Stimulate	18302198
Prostatitis	Associate	21900597
Rectal Neoplasms	Associate	24822274
Stomach Neoplasms	Stimulate	30066917

UGT2B15 (UDP glucuronosyltransferase family 2 member B15)