SCGB1A1 (secretoglobin family 1A member 1)

Gene

• Entrez ID: 7356
• Gene name: Secretoglobin family 1A member 1
• Gene symbol: SCGB1A1
• Synonyms (NCBI Gene): CC10, CC16, CCPBP, CCSP, UGB, UP-1, UP1
• Chromosome: 11
• Chromosome location: 11q12.3
• Summary: This gene encodes a member of the secretoglobin family of small secreted proteins. The encoded protein has been implicated in numerous functions including anti-inflammation, inhibition of phospholipase A2 and the sequestering of hydrophobic ligands. Defec

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1329344	hsa-miR-1273g	CLIP-seq
MIRT1329345	hsa-miR-299-5p	CLIP-seq
MIRT1329346	hsa-miR-4708-5p	CLIP-seq
MIRT1329347	hsa-miR-4709-3p	CLIP-seq
MIRT2097669	hsa-miR-2110	CLIP-seq
MIRT2097670	hsa-miR-3150a-3p	CLIP-seq
MIRT2097671	hsa-miR-4259	CLIP-seq
MIRT2097672	hsa-miR-4450	CLIP-seq
MIRT2321892	hsa-miR-330-3p	CLIP-seq
MIRT2321893	hsa-miR-4422	CLIP-seq
MIRT2321894	hsa-miR-885-3p	CLIP-seq
MIRT2321895	hsa-miR-888	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0005515	Function	Protein binding	IPI	16423471, 18243143, 21516116, 25416956, 28514442, 31515488, 32296183, 32814053, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	21805676
GO:0005615	Component	Extracellular space	IEA
GO:0005635	Component	Nuclear envelope	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	NAS	10587371
GO:0007565	Process	Female pregnancy	NAS	10587371
GO:0007566	Process	Embryo implantation	TAS	10587371
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010193	Process	Response to ozone	IEA
GO:0019834	Function	Phospholipase A2 inhibitor activity	IEA
GO:0030141	Component	Secretory granule	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032689	Process	Negative regulation of type II interferon production	IEA
GO:0032696	Process	Negative regulation of interleukin-13 production	IEA
GO:0032713	Process	Negative regulation of interleukin-4 production	IEA
GO:0032714	Process	Negative regulation of interleukin-5 production	IEA
GO:0034021	Process	Response to silicon dioxide	IEA
GO:0034097	Process	Response to cytokine	IEA
GO:0042098	Process	T cell proliferation	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IEA
GO:0043488	Process	Regulation of mRNA stability	IEA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071774	Process	Response to fibroblast growth factor	IEA
GO:0097160	Function	Polychlorinated biphenyl binding	IEA

Other IDs

• MIM: 192020
• HGNC: 12523
• e!Ensembl: ENSG00000149021

Protein

• UniProt ID: P11684
• Protein name: Uteroglobin (Club cell phospholipid-binding protein) (CCPBP) (Club cells 10 kDa secretory protein) (CC10) (Secretoglobin family 1A member 1) (Urinary protein 1) (UP-1) (UP1) (Urine protein 1)
• Protein function: Binds phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB) and weakly progesterone, potent inhibitor of phospholipase A2.
• PDB: 7VF3, 7VG7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01099	Uteroglobin	1 → 90	Uteroglobin family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Club cells (nonciliated cells of the surface epithelium of the pulmonary airways).
• Sequence:

  MKLAVTLTLVTLALCCSSASAEICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGA
  QLKKLVDTLPQKPRESIIKLMEKIAQSSLCN

• Sequence length: 91

<