Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7351
Gene name Gene Name - the full gene name approved by the HGNC.	Uncoupling protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	UCP2
Synonyms (NCBI Gene) Gene synonyms aliases	BMIQ4, SLC25A8, UCPH
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.4
Summary Summary of gene provided in NCBI Entrez Gene.	Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proto

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs659366	C>T	Risk-factor	Upstream transcript variant
rs371789455	C>T	Likely-benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant

Show/Hide all(216)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004046	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR	21146880
MIRT004046	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR	21146880
MIRT042197	hsa-miR-484	CLASH	23622248
MIRT000330	hsa-miR-133a-3p	Western blot	23988448
MIRT000330	hsa-miR-133a-3p	Western blot	23988448
MIRT494913	hsa-miR-6758-5p	PAR-CLIP	23708386
MIRT494912	hsa-miR-6856-5p	PAR-CLIP	23708386
MIRT494910	hsa-miR-6873-5p	PAR-CLIP	23708386
MIRT494911	hsa-miR-1321	PAR-CLIP	23708386
MIRT494909	hsa-miR-4739	PAR-CLIP	23708386
MIRT494908	hsa-miR-4756-5p	PAR-CLIP	23708386
MIRT494907	hsa-miR-3150b-3p	PAR-CLIP	23708386
MIRT494906	hsa-miR-4784	PAR-CLIP	23708386
MIRT494905	hsa-miR-4419a	PAR-CLIP	23708386
MIRT494904	hsa-miR-4510	PAR-CLIP	23708386
MIRT494903	hsa-miR-6127	PAR-CLIP	23708386
MIRT494902	hsa-miR-6129	PAR-CLIP	23708386
MIRT494901	hsa-miR-6130	PAR-CLIP	23708386
MIRT494900	hsa-miR-6133	PAR-CLIP	23708386
MIRT494899	hsa-miR-139-3p	PAR-CLIP	23708386
MIRT494898	hsa-miR-765	PAR-CLIP	23708386
MIRT494897	hsa-miR-7106-5p	PAR-CLIP	23708386
MIRT494913	hsa-miR-6758-5p	PAR-CLIP	23708386
MIRT494912	hsa-miR-6856-5p	PAR-CLIP	23708386
MIRT494910	hsa-miR-6873-5p	PAR-CLIP	23708386
MIRT494911	hsa-miR-1321	PAR-CLIP	23708386
MIRT494909	hsa-miR-4739	PAR-CLIP	23708386
MIRT494908	hsa-miR-4756-5p	PAR-CLIP	23708386
MIRT494907	hsa-miR-3150b-3p	PAR-CLIP	23708386
MIRT494906	hsa-miR-4784	PAR-CLIP	23708386
MIRT494905	hsa-miR-4419a	PAR-CLIP	23708386
MIRT494904	hsa-miR-4510	PAR-CLIP	23708386
MIRT494903	hsa-miR-6127	PAR-CLIP	23708386
MIRT494902	hsa-miR-6129	PAR-CLIP	23708386
MIRT494901	hsa-miR-6130	PAR-CLIP	23708386
MIRT494900	hsa-miR-6133	PAR-CLIP	23708386
MIRT494899	hsa-miR-139-3p	PAR-CLIP	23708386
MIRT494898	hsa-miR-765	PAR-CLIP	23708386
MIRT494897	hsa-miR-7106-5p	PAR-CLIP	23708386
MIRT1472728	hsa-miR-1226	CLIP-seq
MIRT1472729	hsa-miR-1252	CLIP-seq
MIRT1472730	hsa-miR-1286	CLIP-seq
MIRT1472731	hsa-miR-149	CLIP-seq
MIRT1472732	hsa-miR-1587	CLIP-seq
MIRT1472733	hsa-miR-15a	CLIP-seq
MIRT1472734	hsa-miR-15b	CLIP-seq
MIRT1472735	hsa-miR-16	CLIP-seq
MIRT1472736	hsa-miR-188-3p	CLIP-seq
MIRT1472737	hsa-miR-195	CLIP-seq
MIRT1472738	hsa-miR-2110	CLIP-seq
MIRT1472739	hsa-miR-214	CLIP-seq
MIRT1472740	hsa-miR-3064-5p	CLIP-seq
MIRT1472741	hsa-miR-3153	CLIP-seq
MIRT1472742	hsa-miR-3619-5p	CLIP-seq
MIRT1472743	hsa-miR-3652	CLIP-seq
MIRT1472744	hsa-miR-3668	CLIP-seq
MIRT1472745	hsa-miR-378g	CLIP-seq
MIRT1472746	hsa-miR-383	CLIP-seq
MIRT1472747	hsa-miR-3929	CLIP-seq
MIRT1472748	hsa-miR-424	CLIP-seq
MIRT1472749	hsa-miR-4257	CLIP-seq
MIRT1472750	hsa-miR-4271	CLIP-seq
MIRT1472751	hsa-miR-4291	CLIP-seq
MIRT1472752	hsa-miR-4329	CLIP-seq
MIRT1472753	hsa-miR-4417	CLIP-seq
MIRT1472754	hsa-miR-4419b	CLIP-seq
MIRT1472755	hsa-miR-4430	CLIP-seq
MIRT737925	hsa-miR-4475	CLIP-seq
MIRT1472756	hsa-miR-4478	CLIP-seq
MIRT1472757	hsa-miR-4492	CLIP-seq
MIRT1472758	hsa-miR-4498	CLIP-seq
MIRT1472759	hsa-miR-4505	CLIP-seq
MIRT1472760	hsa-miR-450b-3p	CLIP-seq
MIRT1472761	hsa-miR-4533	CLIP-seq
MIRT1472762	hsa-miR-4536	CLIP-seq
MIRT737924	hsa-miR-4539	CLIP-seq
MIRT1472763	hsa-miR-4656	CLIP-seq
MIRT1472764	hsa-miR-4675	CLIP-seq
MIRT1472765	hsa-miR-4699-5p	CLIP-seq
MIRT1472766	hsa-miR-4713-3p	CLIP-seq
MIRT1472767	hsa-miR-4722-5p	CLIP-seq
MIRT1472768	hsa-miR-4725-3p	CLIP-seq
MIRT1472769	hsa-miR-4741	CLIP-seq
MIRT1472770	hsa-miR-4747-5p	CLIP-seq
MIRT1472771	hsa-miR-4768-3p	CLIP-seq
MIRT1472772	hsa-miR-4772-5p	CLIP-seq
MIRT1472773	hsa-miR-4787-5p	CLIP-seq
MIRT1472774	hsa-miR-4794	CLIP-seq
MIRT1472775	hsa-miR-486-3p	CLIP-seq
MIRT1472776	hsa-miR-491-5p	CLIP-seq
MIRT1472777	hsa-miR-497	CLIP-seq
MIRT1472778	hsa-miR-532-3p	CLIP-seq
MIRT1472779	hsa-miR-580	CLIP-seq
MIRT1472780	hsa-miR-583	CLIP-seq
MIRT1472781	hsa-miR-634	CLIP-seq
MIRT1472782	hsa-miR-638	CLIP-seq
MIRT1472783	hsa-miR-645	CLIP-seq
MIRT1472784	hsa-miR-761	CLIP-seq
MIRT1472785	hsa-miR-762	CLIP-seq
MIRT1472786	hsa-miR-769-3p	CLIP-seq
MIRT1472787	hsa-miR-922	CLIP-seq
MIRT737925	hsa-miR-4475	CLIP-seq
MIRT737924	hsa-miR-4539	CLIP-seq
MIRT2142344	hsa-miR-105	CLIP-seq
MIRT1472728	hsa-miR-1226	CLIP-seq
MIRT2142345	hsa-miR-1246	CLIP-seq
MIRT2142346	hsa-miR-1255a	CLIP-seq
MIRT2142347	hsa-miR-1255b	CLIP-seq
MIRT1472730	hsa-miR-1286	CLIP-seq
MIRT1472731	hsa-miR-149	CLIP-seq
MIRT1472732	hsa-miR-1587	CLIP-seq
MIRT1472739	hsa-miR-214	CLIP-seq
MIRT1472740	hsa-miR-3064-5p	CLIP-seq
MIRT1472742	hsa-miR-3619-5p	CLIP-seq
MIRT1472745	hsa-miR-378g	CLIP-seq
MIRT1472746	hsa-miR-383	CLIP-seq
MIRT1472747	hsa-miR-3929	CLIP-seq
MIRT1472749	hsa-miR-4257	CLIP-seq
MIRT1472751	hsa-miR-4291	CLIP-seq
MIRT1472752	hsa-miR-4329	CLIP-seq
MIRT1472753	hsa-miR-4417	CLIP-seq
MIRT1472754	hsa-miR-4419b	CLIP-seq
MIRT737925	hsa-miR-4475	CLIP-seq
MIRT1472756	hsa-miR-4478	CLIP-seq
MIRT1472757	hsa-miR-4492	CLIP-seq
MIRT1472758	hsa-miR-4498	CLIP-seq
MIRT1472759	hsa-miR-4505	CLIP-seq
MIRT1472762	hsa-miR-4536	CLIP-seq
MIRT737924	hsa-miR-4539	CLIP-seq
MIRT1472763	hsa-miR-4656	CLIP-seq
MIRT1472764	hsa-miR-4675	CLIP-seq
MIRT1472765	hsa-miR-4699-5p	CLIP-seq
MIRT1472769	hsa-miR-4741	CLIP-seq
MIRT1472770	hsa-miR-4747-5p	CLIP-seq
MIRT1472772	hsa-miR-4772-5p	CLIP-seq
MIRT1472773	hsa-miR-4787-5p	CLIP-seq
MIRT1472774	hsa-miR-4794	CLIP-seq
MIRT1472775	hsa-miR-486-3p	CLIP-seq
MIRT2142348	hsa-miR-505	CLIP-seq
MIRT1472779	hsa-miR-580	CLIP-seq
MIRT1472780	hsa-miR-583	CLIP-seq
MIRT1472781	hsa-miR-634	CLIP-seq
MIRT1472783	hsa-miR-645	CLIP-seq
MIRT1472784	hsa-miR-761	CLIP-seq
MIRT1472785	hsa-miR-762	CLIP-seq
MIRT1472787	hsa-miR-922	CLIP-seq
MIRT2142344	hsa-miR-105	CLIP-seq
MIRT1472728	hsa-miR-1226	CLIP-seq
MIRT1472729	hsa-miR-1252	CLIP-seq
MIRT2142346	hsa-miR-1255a	CLIP-seq
MIRT2142347	hsa-miR-1255b	CLIP-seq
MIRT1472730	hsa-miR-1286	CLIP-seq
MIRT1472731	hsa-miR-149	CLIP-seq
MIRT2362880	hsa-miR-1538	CLIP-seq
MIRT1472732	hsa-miR-1587	CLIP-seq
MIRT1472733	hsa-miR-15a	CLIP-seq
MIRT1472734	hsa-miR-15b	CLIP-seq
MIRT1472735	hsa-miR-16	CLIP-seq
MIRT1472736	hsa-miR-188-3p	CLIP-seq
MIRT1472737	hsa-miR-195	CLIP-seq
MIRT1472739	hsa-miR-214	CLIP-seq
MIRT1472740	hsa-miR-3064-5p	CLIP-seq
MIRT1472742	hsa-miR-3619-5p	CLIP-seq
MIRT1472743	hsa-miR-3652	CLIP-seq
MIRT1472744	hsa-miR-3668	CLIP-seq
MIRT1472745	hsa-miR-378g	CLIP-seq
MIRT1472746	hsa-miR-383	CLIP-seq
MIRT1472747	hsa-miR-3929	CLIP-seq
MIRT1472748	hsa-miR-424	CLIP-seq
MIRT1472749	hsa-miR-4257	CLIP-seq
MIRT1472751	hsa-miR-4291	CLIP-seq
MIRT1472752	hsa-miR-4329	CLIP-seq
MIRT1472753	hsa-miR-4417	CLIP-seq
MIRT1472754	hsa-miR-4419b	CLIP-seq
MIRT1472755	hsa-miR-4430	CLIP-seq
MIRT737925	hsa-miR-4475	CLIP-seq
MIRT1472756	hsa-miR-4478	CLIP-seq
MIRT1472757	hsa-miR-4492	CLIP-seq
MIRT1472758	hsa-miR-4498	CLIP-seq
MIRT1472759	hsa-miR-4505	CLIP-seq
MIRT1472760	hsa-miR-450b-3p	CLIP-seq
MIRT1472761	hsa-miR-4533	CLIP-seq
MIRT1472762	hsa-miR-4536	CLIP-seq
MIRT737924	hsa-miR-4539	CLIP-seq
MIRT1472763	hsa-miR-4656	CLIP-seq
MIRT1472764	hsa-miR-4675	CLIP-seq
MIRT1472765	hsa-miR-4699-5p	CLIP-seq
MIRT1472766	hsa-miR-4713-3p	CLIP-seq
MIRT1472767	hsa-miR-4722-5p	CLIP-seq
MIRT1472769	hsa-miR-4741	CLIP-seq
MIRT2362881	hsa-miR-4745-3p	CLIP-seq
MIRT1472770	hsa-miR-4747-5p	CLIP-seq
MIRT1472771	hsa-miR-4768-3p	CLIP-seq
MIRT1472772	hsa-miR-4772-5p	CLIP-seq
MIRT1472773	hsa-miR-4787-5p	CLIP-seq
MIRT1472774	hsa-miR-4794	CLIP-seq
MIRT1472775	hsa-miR-486-3p	CLIP-seq
MIRT1472776	hsa-miR-491-5p	CLIP-seq
MIRT1472777	hsa-miR-497	CLIP-seq
MIRT2142348	hsa-miR-505	CLIP-seq
MIRT1472778	hsa-miR-532-3p	CLIP-seq
MIRT1472779	hsa-miR-580	CLIP-seq
MIRT1472780	hsa-miR-583	CLIP-seq
MIRT1472781	hsa-miR-634	CLIP-seq
MIRT1472782	hsa-miR-638	CLIP-seq
MIRT1472783	hsa-miR-645	CLIP-seq
MIRT1472784	hsa-miR-761	CLIP-seq
MIRT1472785	hsa-miR-762	CLIP-seq
MIRT1472786	hsa-miR-769-3p	CLIP-seq
MIRT1472787	hsa-miR-922	CLIP-seq
MIRT1472728	hsa-miR-1226	CLIP-seq
MIRT1472752	hsa-miR-4329	CLIP-seq
MIRT737925	hsa-miR-4475	CLIP-seq
MIRT737924	hsa-miR-4539	CLIP-seq
MIRT2142348	hsa-miR-505	CLIP-seq
MIRT1472781	hsa-miR-634	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
SMAD4	Unknown	21935467
STAT3	Repression	21344490

Show/Hide all(64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000266	Process	Mitochondrial fission	IEA
GO:0000266	Process	Mitochondrial fission	ISS
GO:0000303	Process	Response to superoxide	IEA
GO:0001666	Process	Response to hypoxia	IDA	22292025
GO:0001666	Process	Response to hypoxia	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 27642082
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	9196039
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006096	Process	Glycolytic process	IMP	24395786
GO:0006541	Process	Glutamine metabolic process	IMP	24395786
GO:0006839	Process	Mitochondrial transport	IEA
GO:0008271	Function	Secondary active sulfate transmembrane transporter activity	IDA	24395786
GO:0009409	Process	Response to cold	IBA
GO:0009749	Process	Response to glucose	IEA
GO:0015078	Function	Proton transmembrane transporter activity	IDA	22524567, 26182433, 33373220
GO:0015078	Function	Proton transmembrane transporter activity	IEA
GO:0015108	Function	Chloride transmembrane transporter activity	IDA	22524567, 26182433
GO:0015131	Function	Oxaloacetate transmembrane transporter activity	IDA	24395786
GO:0015140	Function	Malate transmembrane transporter activity	IDA	24395786
GO:0015183	Function	L-aspartate transmembrane transporter activity	IDA	24395786
GO:0015297	Function	Antiporter activity	IDA	24395786
GO:0015698	Process	Inorganic anion transport	IEA
GO:0015740	Process	C4-dicarboxylate transport	IMP	24395786
GO:0015909	Process	Long-chain fatty acid transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0017077	Function	Oxidative phosphorylation uncoupler activity	IBA
GO:0019003	Function	GDP binding	IEA
GO:0030225	Process	Macrophage differentiation	IEA
GO:0030225	Process	Macrophage differentiation	ISS
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IEA
GO:0034198	Process	Cellular response to amino acid starvation	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	26182433, 33373220
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0051881	Process	Regulation of mitochondrial membrane potential	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0061179	Process	Negative regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0070542	Process	Response to fatty acid	IEA
GO:0070778	Process	L-aspartate transmembrane transport	IEA
GO:0071284	Process	Cellular response to lead ion	IEA
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071333	Process	Cellular response to glucose stimulus	ISS
GO:0071423	Process	Malate transmembrane transport	IEA
GO:0071548	Process	Response to dexamethasone	IEA
GO:0072593	Process	Reactive oxygen species metabolic process	IEA
GO:0072593	Process	Reactive oxygen species metabolic process	ISS
GO:0097421	Process	Liver regeneration	IEA
GO:0110099	Process	Negative regulation of calcium import into the mitochondrion	IDA	27642082
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	28130074
GO:0140787	Function	Phosphate ion uniporter activity	IDA	24395786
GO:1902356	Process	Oxaloacetate(2-) transmembrane transport	IEA
GO:1902358	Process	Sulfate transmembrane transport	IEA
GO:1902476	Process	Chloride transmembrane transport	IEA
GO:1902600	Process	Proton transmembrane transport	TAS	9054939
GO:1990542	Process	Mitochondrial transmembrane transport	IBA
GO:1990542	Process	Mitochondrial transmembrane transport	IMP	24395786
GO:1990845	Process	Adaptive thermogenesis	IBA

MIM	HGNC	e!Ensembl
601693	12518	ENSG00000175567

Protein

UniProt ID

P55851

Protein name

Dicarboxylate carrier SLC25A8 (Mitochondrial uncoupling protein 2) (UCP 2) (Solute carrier family 25 member 8) (UCPH)

Protein function

Antiporter that exports dicarboxylate intermediates of the Krebs cycle in exchange for phosphate plus a proton across the inner membrane of mitochondria, a process driven by mitochondrial motive force with an overall impact on glycolysis, glutam

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00153	Mito_carr	10 → 111	Mitochondrial carrier protein	Family
PF00153	Mito_carr	112 → 208	Mitochondrial carrier protein	Family
PF00153	Mito_carr	211 → 301	Mitochondrial carrier protein	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed in adult human tissues, including tissues rich in macrophages. Most expressed in white adipose tissue and skeletal muscle. {ECO:0000269|PubMed:9054939}.

Sequence

MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGPVRATASAQYR
GVMGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHASIGSRL
LAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREEGFRGLWKGTS
PNVARNAIVNCAELVTYDLIKDALLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT
RYMNSALGQYSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA
ACTSREAPF

Sequence length

309

Interactions

View interactions

	Reactome
			The fatty acid cycling model The proton buffering model

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Hyperinsulinism	hyperinsulinism due to UCP2 deficiency	N/A	N/A	GenCC

Show/Hide Text Mining Associations (110)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abdominal Injuries	Associate	19056576
Acute Coronary Syndrome	Associate	20145583
Adenocarcinoma	Associate	27478826, 31275989
Angina Pectoris	Associate	18192542
Arterial Occlusive Diseases	Inhibit	25944698
Arthritis Rheumatoid	Associate	32650679
Atherosclerosis	Inhibit	15905464
Autism Spectrum Disorder	Associate	27864377
Breast Neoplasms	Associate	21364658, 21935467, 23257779, 26666173, 34146128, 40362341
Calcinosis	Associate	37679327
Cancer Pain	Associate	39469880
Carcinogenesis	Stimulate	31085159
Carcinoma Hepatocellular	Associate	25512910, 26181366, 27129291
Carcinoma Non Small Cell Lung	Associate	28042952, 28258342, 36833388, 37744277
Cardiovascular Diseases	Associate	20937264, 23537071
Cell Transformation Neoplastic	Stimulate	21935467
Cerebral Infarction	Associate	20937264, 22613561
Cholangiocarcinoma	Associate	31085159
Colorectal Neoplasms	Associate	21128330, 23826253, 26148070, 33859525
Colorectal Neoplasms	Stimulate	24440978
Colorectal Neoplasms	Inhibit	29085228
Congenital Hyperinsulinism	Associate	27967291
Coronary Artery Disease	Associate	18192542, 23537071
Coronary Disease	Associate	19527523, 34883250
Death	Associate	23537071
Death Sudden	Associate	18192542
Diabetes Mellitus	Associate	11904148, 12915397, 19527523, 19769793, 20145583, 22613561, 24440978, 25396419, 27615599, 29151065
Diabetes Mellitus Type 2	Associate	12690079, 12915397, 15774022, 18192542, 18324929, 18496642, 19137581, 19659999, 20142250, 21029457, 21074158, 21873561, 22533685, 22613561, 23133645 View all (7 more)
Diabetes Mellitus Type 2	Stimulate	15654602
Diabetic Nephropathies	Associate	26218518
Diabetic Retinopathy	Associate	25396419
Diabetic Retinopathy	Inhibit	38175638
Drug Related Side Effects and Adverse Reactions	Associate	19763737, 35409033
Dyslipidemias	Associate	30100544
Endocrine System Diseases	Associate	26666173
Fanconi Anemia	Associate	37047537
Fatty Liver	Associate	23151243
Glomerulonephritis Membranous	Associate	15905464
Head and Neck Neoplasms	Stimulate	24440978
Hearing Loss Sensorineural	Associate	30100544
Hearing Loss Sudden	Associate	30100544
Heart Defects Congenital	Associate	33888769
Heat Stroke	Stimulate	35129048
Hepatoblastoma	Associate	27129291
Hyperglycemia	Associate	18167556, 25910810, 38175638
Hyperinsulinism	Associate	27967291
Hypersensitivity Immediate	Associate	32840960
Hypertension	Associate	30100544, 40438943
Hypertension Pulmonary	Associate	29070699
Hyperthyroidism	Associate	17389707
Hypertriglyceridemia	Associate	16741267
Hyperuricemia	Associate	27273589
Hypoglycemia	Associate	27967291
Hypoxia	Inhibit	28042952, 39271430
Hypoxia	Associate	28258342
Hypoxia Brain	Associate	22292025
Immune System Diseases	Associate	29151065
Inflammation	Associate	19527523, 24341743, 28487946, 30007886
Insulin Resistance	Associate	19556617, 23826253
Leukemia	Associate	18593920, 23069211, 36275699
Leukemia Myeloid Acute	Associate	38077322
Lymphatic Metastasis	Associate	33125133
Metabolic Diseases	Associate	16741267
Metabolic Diseases	Inhibit	29151065
Metabolic Syndrome	Associate	15905464, 16741267, 20145583, 27301474
Mitochondrial Diseases	Associate	17472436, 18332166
Mitochondrial Diseases	Stimulate	23257779
Mood Disorders	Associate	28771482
Multiple Myeloma	Associate	34481515
Myocardial Infarction	Associate	18192542, 19527523, 23537071
Myotonic Dystrophy	Associate	32553458
Neoplasms	Associate	21364658, 22292025, 22705884, 23069211, 23124112, 24395786, 24440978, 28258342, 30318520, 33125133, 33859525, 35090503, 36254139, 39469880, 40362341
Neoplasms	Stimulate	21935467, 31085159, 34146128
Neoplasms	Inhibit	23257779
Neoplasms Adipose Tissue	Associate	10760107, 16741267, 18234126, 32858880
Neural Tube Defects	Associate	19137581, 23132673
Neuroblastoma	Associate	35531888
Nociceptive Pain	Associate	10760107
Non alcoholic Fatty Liver Disease	Associate	25512910, 27301474
Obesity	Associate	10102249, 10837279, 11904148, 12690079, 12740453, 12915397, 15833942, 16741267, 18234126, 18496642, 19039313, 19137581, 19769793, 20054173, 22533685 View all (11 more)
Obesity Abdominal	Associate	19769793
Obesity Maternal	Stimulate	26513002
Osteoarthritis	Associate	38292759
Ovarian Neoplasms	Associate	21935467
Ovarian Neoplasms	Stimulate	40269926
Overweight	Associate	10837279, 19039313, 27273589, 28686191, 32398726
Pancreatic Neoplasms	Associate	23124112
Pancreatic Neoplasms	Stimulate	24440978
Pancreatitis	Inhibit	15833942
Parkinson Disease	Associate	24251413
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	36275699
Prediabetic State	Associate	29529994, 32553458
Prostatic Neoplasms	Associate	20142250
Prostatitis	Stimulate	24440978
Pulmonary Arterial Hypertension	Associate	28977211
Pulmonary Edema	Associate	34883250
Renal Insufficiency Chronic	Associate	19406964
Sepsis	Associate	19556617
Sleep Deprivation	Inhibit	35129048
Small Cell Lung Carcinoma	Inhibit	24440978
Stroke	Associate	23537071
Tertiary Lymphoid Structures	Stimulate	31085159
Testicular Germ Cell Tumor	Inhibit	39469880
Thrombophilia	Associate	37098010
Thyroid Cancer Papillary	Associate	26450681
Uterine Cervical Neoplasms	Associate	32190174, 33125133
Vascular Diseases	Inhibit	35129048
Vascular Diseases	Associate	38175638
Vascular System Injuries	Associate	35129048
Weight Loss	Associate	10102249, 34883250

UCP2 (uncoupling protein 2)