Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7350
Gene name Gene Name - the full gene name approved by the HGNC.	Uncoupling protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	UCP1
Synonyms (NCBI Gene) Gene synonyms aliases	SLC25A7, UCP
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q31.1
Summary Summary of gene provided in NCBI Entrez Gene.	Mitochondrial uncoupling proteins (UCP) are members of the family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak.

Show/Hide all(58)

miRTarBase ID	miRNA	Experiments	Reference
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT510003	hsa-miR-4251	PAR-CLIP	20371350
MIRT510002	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT510003	hsa-miR-4251	PAR-CLIP	20371350
MIRT510002	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT510003	hsa-miR-4251	PAR-CLIP	20371350
MIRT510002	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	21572407
MIRT510003	hsa-miR-4251	PAR-CLIP	21572407
MIRT510002	hsa-miR-539-5p	PAR-CLIP	21572407
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT531849	hsa-miR-4328	PAR-CLIP	22012620
MIRT531848	hsa-miR-627-3p	PAR-CLIP	22012620
MIRT531847	hsa-miR-6794-3p	PAR-CLIP	22012620
MIRT531846	hsa-miR-6505-5p	PAR-CLIP	22012620
MIRT531844	hsa-miR-3692-3p	PAR-CLIP	22012620
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	23446348
MIRT510003	hsa-miR-4251	PAR-CLIP	23446348
MIRT510002	hsa-miR-539-5p	PAR-CLIP	23446348
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	23446348
MIRT510003	hsa-miR-4251	PAR-CLIP	23446348
MIRT510002	hsa-miR-539-5p	PAR-CLIP	23446348
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT510003	hsa-miR-4251	PAR-CLIP	20371350
MIRT510002	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT510003	hsa-miR-4251	PAR-CLIP	20371350
MIRT510002	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT510003	hsa-miR-4251	PAR-CLIP	20371350
MIRT510002	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	21572407
MIRT510003	hsa-miR-4251	PAR-CLIP	21572407
MIRT510002	hsa-miR-539-5p	PAR-CLIP	21572407
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT531849	hsa-miR-4328	PAR-CLIP	22012620
MIRT531848	hsa-miR-627-3p	PAR-CLIP	22012620
MIRT531847	hsa-miR-6794-3p	PAR-CLIP	22012620
MIRT531846	hsa-miR-6505-5p	PAR-CLIP	22012620
MIRT531844	hsa-miR-3692-3p	PAR-CLIP	22012620
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	23446348
MIRT510003	hsa-miR-4251	PAR-CLIP	23446348
MIRT510002	hsa-miR-539-5p	PAR-CLIP	23446348
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	23446348
MIRT510003	hsa-miR-4251	PAR-CLIP	23446348
MIRT510002	hsa-miR-539-5p	PAR-CLIP	23446348
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	23446348

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
PPARA	Repression	11875072
VDR	Unknown	23906633

Show/Hide all(58)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002024	Process	Diet induced thermogenesis	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005525	Function	GTP binding	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	9054939
GO:0005739	Component	Mitochondrion	IEA
GO:0005740	Component	Mitochondrial envelope	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	9054939
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	ISS
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006839	Process	Mitochondrial transport	IEA
GO:0009266	Process	Response to temperature stimulus	IEA
GO:0009266	Process	Response to temperature stimulus	ISS
GO:0009409	Process	Response to cold	IBA
GO:0015078	Function	Proton transmembrane transporter activity	IDA	28781081
GO:0016020	Component	Membrane	IEA
GO:0017077	Function	Oxidative phosphorylation uncoupler activity	IBA
GO:0017077	Function	Oxidative phosphorylation uncoupler activity	IEA
GO:0017077	Function	Oxidative phosphorylation uncoupler activity	ISS
GO:0019003	Function	GDP binding	IEA
GO:0022857	Function	Transmembrane transporter activity	IDA	24196960
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0031667	Process	Response to nutrient levels	IEA
GO:0031667	Process	Response to nutrient levels	ISS
GO:0032555	Function	Purine ribonucleotide binding	IEA
GO:0032555	Function	Purine ribonucleotide binding	ISS
GO:0032870	Process	Cellular response to hormone stimulus	IEA
GO:0032870	Process	Cellular response to hormone stimulus	ISS
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034614	Process	Cellular response to reactive oxygen species	IEA
GO:0034614	Process	Cellular response to reactive oxygen species	ISS
GO:0036041	Function	Long-chain fatty acid binding	IDA	28781081
GO:0036041	Function	Long-chain fatty acid binding	IEA
GO:0036041	Function	Long-chain fatty acid binding	ISS
GO:0043168	Function	Anion binding	IEA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0050873	Process	Brown fat cell differentiation	ISS
GO:0055085	Process	Transmembrane transport	IEA
GO:0070417	Process	Cellular response to cold	IEA
GO:0071398	Process	Cellular response to fatty acid	IEA
GO:0071398	Process	Cellular response to fatty acid	ISS
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	28630339
GO:1901612	Function	Cardiolipin binding	ISS
GO:1902600	Process	Proton transmembrane transport	IDA	24196960, 28781081
GO:1902600	Process	Proton transmembrane transport	IEA
GO:1903426	Process	Regulation of reactive oxygen species biosynthetic process	IEA
GO:1903426	Process	Regulation of reactive oxygen species biosynthetic process	ISS
GO:1903495	Process	Cellular response to dehydroepiandrosterone	IEA
GO:1990542	Process	Mitochondrial transmembrane transport	IBA
GO:1990542	Process	Mitochondrial transmembrane transport	IEA
GO:1990542	Process	Mitochondrial transmembrane transport	ISS
GO:1990845	Process	Adaptive thermogenesis	IBA
GO:1990845	Process	Adaptive thermogenesis	IEA
GO:1990845	Process	Adaptive thermogenesis	ISS

MIM	HGNC	e!Ensembl
113730	12517	ENSG00000109424

Protein

UniProt ID

P25874

Protein name

Mitochondrial brown fat uncoupling protein 1 (UCP 1) (Solute carrier family 25 member 7) (Thermogenin)

Protein function

Mitochondrial protein responsible for thermogenic respiration, a specialized capacity of brown adipose tissue and beige fat that participates in non-shivering adaptive thermogenesis to temperature and diet variations and more generally to the re

PDB

8G8W , 8HBV , 8HBW , 8J1N

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00153	Mito_carr	10 → 107	Mitochondrial carrier protein	Family
PF00153	Mito_carr	110 → 206	Mitochondrial carrier protein	Family
PF00153	Mito_carr	210 → 300	Mitochondrial carrier protein	Family

Tissue specificity

TISSUE SPECIFICITY: Brown adipose tissue. {ECO:0000269|PubMed:3165741}.

Sequence

MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLG
TITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAG
LTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPN
LMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRF
INSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSR
QTMDCAT

Sequence length

307

Interactions

View interactions

	KEGG		Reactome
	PPAR signaling pathway Apelin signaling pathway Thermogenesis Huntington disease		The fatty acid cycling model The proton buffering model

UCP1 (uncoupling protein 1)