Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7350
Gene name	Uncoupling protein 1
Gene symbol	UCP1
Synonyms (NCBI Gene)	SLC25A7UCP
Chromosome	4
Chromosome location	4q31.1
Summary	Mitochondrial uncoupling proteins (UCP) are members of the family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak.

Show/Hide all (58)

miRTarBase ID	miRNA	Experiments	Reference
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT510003	hsa-miR-4251	PAR-CLIP	20371350
MIRT510002	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT510003	hsa-miR-4251	PAR-CLIP	20371350
MIRT510002	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT510003	hsa-miR-4251	PAR-CLIP	20371350
MIRT510002	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	21572407
MIRT510003	hsa-miR-4251	PAR-CLIP	21572407
MIRT510002	hsa-miR-539-5p	PAR-CLIP	21572407
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT531849	hsa-miR-4328	PAR-CLIP	22012620
MIRT531848	hsa-miR-627-3p	PAR-CLIP	22012620
MIRT531847	hsa-miR-6794-3p	PAR-CLIP	22012620
MIRT531846	hsa-miR-6505-5p	PAR-CLIP	22012620
MIRT531844	hsa-miR-3692-3p	PAR-CLIP	22012620
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	23446348
MIRT510003	hsa-miR-4251	PAR-CLIP	23446348
MIRT510002	hsa-miR-539-5p	PAR-CLIP	23446348
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	23446348
MIRT510003	hsa-miR-4251	PAR-CLIP	23446348
MIRT510002	hsa-miR-539-5p	PAR-CLIP	23446348
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT510003	hsa-miR-4251	PAR-CLIP	20371350
MIRT510002	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT510003	hsa-miR-4251	PAR-CLIP	20371350
MIRT510002	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT510003	hsa-miR-4251	PAR-CLIP	20371350
MIRT510002	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	21572407
MIRT510003	hsa-miR-4251	PAR-CLIP	21572407
MIRT510002	hsa-miR-539-5p	PAR-CLIP	21572407
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT531849	hsa-miR-4328	PAR-CLIP	22012620
MIRT531848	hsa-miR-627-3p	PAR-CLIP	22012620
MIRT531847	hsa-miR-6794-3p	PAR-CLIP	22012620
MIRT531846	hsa-miR-6505-5p	PAR-CLIP	22012620
MIRT531844	hsa-miR-3692-3p	PAR-CLIP	22012620
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	23446348
MIRT510003	hsa-miR-4251	PAR-CLIP	23446348
MIRT510002	hsa-miR-539-5p	PAR-CLIP	23446348
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT510004	hsa-miR-548at-5p	PAR-CLIP	23446348
MIRT510003	hsa-miR-4251	PAR-CLIP	23446348
MIRT510002	hsa-miR-539-5p	PAR-CLIP	23446348
MIRT510001	hsa-miR-4668-5p	PAR-CLIP	23446348

Show/Hide all (2)

Transcription factor	Regulation	Reference
PPARA	Repression	11875072
VDR	Unknown	23906633

Show/Hide all (58)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002024	Process	Diet induced thermogenesis	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005525	Function	GTP binding	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	9054939
GO:0005739	Component	Mitochondrion	IEA
GO:0005740	Component	Mitochondrial envelope	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	9054939
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	ISS
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006839	Process	Mitochondrial transport	IEA
GO:0009266	Process	Response to temperature stimulus	IEA
GO:0009266	Process	Response to temperature stimulus	ISS
GO:0009409	Process	Response to cold	IBA
GO:0015078	Function	Proton transmembrane transporter activity	IDA	28781081
GO:0016020	Component	Membrane	IEA
GO:0017077	Function	Oxidative phosphorylation uncoupler activity	IBA
GO:0017077	Function	Oxidative phosphorylation uncoupler activity	IEA
GO:0017077	Function	Oxidative phosphorylation uncoupler activity	ISS
GO:0019003	Function	GDP binding	IEA
GO:0022857	Function	Transmembrane transporter activity	IDA	24196960
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0031667	Process	Response to nutrient levels	IEA
GO:0031667	Process	Response to nutrient levels	ISS
GO:0032555	Function	Purine ribonucleotide binding	IEA
GO:0032555	Function	Purine ribonucleotide binding	ISS
GO:0032870	Process	Cellular response to hormone stimulus	IEA
GO:0032870	Process	Cellular response to hormone stimulus	ISS
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034614	Process	Cellular response to reactive oxygen species	IEA
GO:0034614	Process	Cellular response to reactive oxygen species	ISS
GO:0036041	Function	Long-chain fatty acid binding	IDA	28781081
GO:0036041	Function	Long-chain fatty acid binding	IEA
GO:0036041	Function	Long-chain fatty acid binding	ISS
GO:0043168	Function	Anion binding	IEA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0050873	Process	Brown fat cell differentiation	ISS
GO:0055085	Process	Transmembrane transport	IEA
GO:0070417	Process	Cellular response to cold	IEA
GO:0071398	Process	Cellular response to fatty acid	IEA
GO:0071398	Process	Cellular response to fatty acid	ISS
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	28630339
GO:1901612	Function	Cardiolipin binding	ISS
GO:1902600	Process	Proton transmembrane transport	IDA	24196960, 28781081
GO:1902600	Process	Proton transmembrane transport	IEA
GO:1903426	Process	Regulation of reactive oxygen species biosynthetic process	IEA
GO:1903426	Process	Regulation of reactive oxygen species biosynthetic process	ISS
GO:1903495	Process	Cellular response to dehydroepiandrosterone	IEA
GO:1990542	Process	Mitochondrial transmembrane transport	IBA
GO:1990542	Process	Mitochondrial transmembrane transport	IEA
GO:1990542	Process	Mitochondrial transmembrane transport	ISS
GO:1990845	Process	Adaptive thermogenesis	IBA
GO:1990845	Process	Adaptive thermogenesis	IEA
GO:1990845	Process	Adaptive thermogenesis	ISS

MIM	HGNC	e!Ensembl
113730	12517	ENSG00000109424

P25874

Protein name

Mitochondrial brown fat uncoupling protein 1 (UCP 1) (Solute carrier family 25 member 7) (Thermogenin)

Protein function

Mitochondrial protein responsible for thermogenic respiration, a specialized capacity of brown adipose tissue and beige fat that participates in non-shivering adaptive thermogenesis to temperature and diet variations and more generally to the re

PDB

8G8W , 8HBV , 8HBW , 8J1N

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00153	Mito_carr	10 → 107	Mitochondrial carrier protein	Family
PF00153	Mito_carr	110 → 206	Mitochondrial carrier protein	Family
PF00153	Mito_carr	210 → 300	Mitochondrial carrier protein	Family

Tissue specificity

TISSUE SPECIFICITY: Brown adipose tissue. {ECO:0000269|PubMed:3165741}.

Sequence

MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLG
TITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAG
LTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPN
LMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRF
INSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSR
QTMDCAT

Sequence length

307

Interactions

View interactions

	KEGG		Reactome
	PPAR signaling pathway Apelin signaling pathway Thermogenesis Huntington disease		The fatty acid cycling model The proton buffering model

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
UCP1 POLYMORPHISM	Benign	rs1800592	RCV000019227

Show/Hide Text Mining Associations (44)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Arthritis Rheumatoid	Associate	34067093
Atelosteogenesis type 2	Associate	29077154
Atrial Fibrillation	Inhibit	29077154
Bone Neoplasms	Associate	21355075
Breast Neoplasms	Associate	23257779, 32819314
Carcinogenesis	Associate	35090503
Carcinoma Renal Cell	Associate	31545449
Carotid Stenosis	Associate	22087257
Colonic Neoplasms	Associate	36254139
Coronary Artery Disease	Associate	27542888
Diabetes Mellitus	Associate	16538490, 19556617, 23134754, 36768561
Diabetes Mellitus Type 2	Associate	16538490, 25274455, 28591028, 28824327, 30458724
Diabetic Retinopathy	Associate	25274455, 29410390, 32028915
Dyslipidemias	Associate	26332421
Embolism Fat	Associate	21959333, 24086366
Endometriosis	Associate	39244839
Heart Failure	Inhibit	28824327
Heart Failure	Associate	30272299
Hereditary Breast and Ovarian Cancer Syndrome	Stimulate	37181035
Hypoglycemia	Associate	28591028
Immunologic Deficiency Syndromes	Associate	23043591
Insulin Resistance	Associate	25274455, 34067093
Jaundice Chronic Idiopathic	Stimulate	21541183
Lipomatosis Multiple Symmetrical	Associate	30815996
Metabolic Diseases	Associate	12375583, 23043591, 35691529
Metabolic Syndrome	Associate	22811361, 25646961, 37107547
Mitochondrial Diseases	Stimulate	23257779
Myotonic Dystrophy	Inhibit	27542888
Myotonic Dystrophy	Associate	28591028
Neoplasm Metastasis	Associate	21355075, 35090503
Neoplasms	Inhibit	19753307, 23257779, 32232960
Neoplasms	Associate	35090503
Neoplasms	Stimulate	36402906
Neoplasms Adipose Tissue	Associate	18234126, 32858880, 34067093
Obesity	Associate	18234126, 19966534, 20622171, 20803423, 21959333, 23043591, 23101559, 23134754, 24086366, 24141239, 25928572, 27560134, 29796650, 30458724, 32325455 View all (6 more)
Obesity	Inhibit	24642703
Ovarian Neoplasms	Associate	35090503
Overweight	Associate	30580338, 34067093
Prostatic Neoplasms	Associate	21355075
Simpson Golabi Behmel syndrome	Associate	30967578
Stomach Neoplasms	Stimulate	36254139
Stroke	Associate	23043591
Varicose Ulcer	Associate	23043591
Weight Loss	Associate	20803423, 38069028

UCP1 (uncoupling protein 1)