Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7349
Gene name Gene Name - the full gene name approved by the HGNC.	Urocortin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	UCN
Synonyms (NCBI Gene) Gene synonyms aliases	UCN1, UI, UROC
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2p23.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the sauvagine/corticotropin-releasing factor/urotensin I family. The encoded preproprotein is proteolytically processed to generate the mature peptide, an endogenous ligand for both corticotropin-releasing factor receptor 1 a

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
AR	Repression	23801677

Show/Hide all(57)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IEA
GO:0001964	Process	Startle response	IEA
GO:0005179	Function	Hormone activity	IEA
GO:0005184	Function	Neuropeptide hormone activity	TAS	8612563
GO:0005515	Function	Protein binding	IPI	18234674
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0006979	Process	Response to oxidative stress	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8612563
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0007605	Process	Sensory perception of sound	IEA
GO:0007611	Process	Learning or memory	IEA
GO:0007631	Process	Feeding behavior	IEA
GO:0008306	Process	Associative learning	IEA
GO:0009060	Process	Aerobic respiration	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010996	Process	Response to auditory stimulus	IEA
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0031175	Process	Neuron projection development	IEA
GO:0032099	Process	Negative regulation of appetite	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IEA
GO:0035176	Process	Social behavior	IEA
GO:0042311	Process	Vasodilation	IEA
GO:0042756	Process	Drinking behavior	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043117	Process	Positive regulation of vascular permeability	IEA
GO:0043196	Component	Varicosity	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043679	Component	Axon terminus	IEA
GO:0045727	Process	Positive regulation of translation	IEA
GO:0045740	Process	Positive regulation of DNA replication	IEA
GO:0045776	Process	Negative regulation of blood pressure	IEA
GO:0045792	Process	Negative regulation of cell size	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046811	Function	Histone deacetylase inhibitor activity	IEA
GO:0046888	Process	Negative regulation of hormone secretion	IEA
GO:0048265	Process	Response to pain	IEA
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0051430	Function	Corticotropin-releasing hormone receptor 1 binding	IEA
GO:0051431	Function	Corticotropin-releasing hormone receptor 2 binding	IEA
GO:0051461	Process	Positive regulation of corticotropin secretion	IDA	11329063
GO:0051461	Process	Positive regulation of corticotropin secretion	IEA
GO:0051966	Process	Regulation of synaptic transmission, glutamatergic	IEA
GO:0060452	Process	Positive regulation of cardiac muscle contraction	IEA
GO:0090280	Process	Positive regulation of calcium ion import	IEA
GO:0141163	Process	Positive regulation of cAMP/PKA signal transduction	IEA
GO:2000252	Process	Negative regulation of feeding behavior	IBA
GO:2000252	Process	Negative regulation of feeding behavior	IEA
GO:2000987	Process	Positive regulation of behavioral fear response	IEA

MIM	HGNC	e!Ensembl
600945	12516	ENSG00000163794

Protein

UniProt ID

P55089

Protein name

Urocortin

Protein function

Acts in vitro to stimulate the secretion of adrenocorticotropic hormone (ACTH) (PubMed:8612563). Binds with high affinity to CRF receptor types 1, 2-alpha, and 2-beta (PubMed:8612563). Plays a role in the establishment of normal hearing threshol

PDB

2RMF , 3N96 , 6PB0 , 6PB1 , 7TRY , 7TS0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00473	CRF	85 → 122	Corticotropin-releasing factor family	Family

Tissue specificity

TISSUE SPECIFICITY: Keratinocytes in epidermis and the outer and inner root sheaths of hair follicles, epithelium of sebaceous and sweat glands, erector pili muscle, cutaneous blood vessel walls, cutaneous nerves and dermal mononuclear cells (PubMed:10690

Sequence

MRQAGRAALLAALLLLVQLCPGSSQRSPEAAGVQDPSLRWSPGARNQGGGARALLLLLAE
RFPRRAGPGRLGLGTAGERPRRDNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFD
SVGK

Sequence length

124

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Hormone signaling		Class B/2 (Secretin family receptors) Synthesis, secretion, and deacylation of Ghrelin

UCN (urocortin)