Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	733
Gene name Gene Name - the full gene name approved by the HGNC.	Complement C8 gamma chain
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	C8G
Synonyms (NCBI Gene) Gene synonyms aliases	C8C
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9q34.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the lipocalin family. It is one of the three subunits that constitutes complement component 8 (C8), which is composed of a disulfide-linked C8 alpha-gamma heterodimer and a non-covalently associated C8 beta chai

Show/Hide all(8)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017056	hsa-miR-335-5p	Microarray	18185580
MIRT852923	hsa-miR-326	CLIP-seq
MIRT852924	hsa-miR-330-5p	CLIP-seq
MIRT852925	hsa-miR-3909	CLIP-seq
MIRT852926	hsa-miR-4667-5p	CLIP-seq
MIRT852927	hsa-miR-4700-5p	CLIP-seq
MIRT852928	hsa-miR-486-3p	CLIP-seq
MIRT852929	hsa-miR-637	CLIP-seq

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005579	Component	Membrane attack complex	IDA	26841837, 27052168, 30552328, 30643019, 31061395, 36797260
GO:0005579	Component	Membrane attack complex	IEA
GO:0005579	Component	Membrane attack complex	IPI	30552328
GO:0005886	Component	Plasma membrane	NAS	30552328
GO:0006956	Process	Complement activation	IDA	26841837, 27052168
GO:0006956	Process	Complement activation	IEA
GO:0006957	Process	Complement activation, alternative pathway	IEA
GO:0006958	Process	Complement activation, classical pathway	IEA
GO:0016020	Component	Membrane	IEA
GO:0019841	Function	Retinol binding	IEA
GO:0031640	Process	Killing of cells of another organism	IEA
GO:0044218	Component	Other organism cell membrane	IDA	27052168
GO:0044218	Component	Other organism cell membrane	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0050778	Process	Positive regulation of immune response	NAS	30552328
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0160257	Process	Complement activation, GZMK pathway	IDA	39914456
GO:1902495	Component	Transmembrane transporter complex	IDA	30552328

MIM	HGNC	e!Ensembl
120930	1354	ENSG00000176919

Protein

UniProt ID

P07360

Protein name

Complement component C8 gamma chain

Protein function

Component of the membrane attack complex (MAC), a multiprotein complex activated by the complement cascade, which inserts into a target cell membrane and forms a pore, leading to target cell membrane rupture and cell lysis (PubMed:26841837, PubM

PDB

1IW2 , 1LF7 , 2OVA , 2OVD , 2OVE , 2QOS , 2RD7 , 3OJY , 6H03 , 6H04 , 7NYC , 7NYD , 8B0F , 8B0G , 8B0H

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00061	Lipocalin	48 → 186	Lipocalin / cytosolic fatty-acid binding protein family	Domain

Sequence

MLPPGTATLLTLLLAAGSLGQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSAC
RFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDAR
GAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIF
YFPKYGFCEAADQFHVLDEVRR

Sequence length

202

Interactions

View interactions

	KEGG		Reactome
	Complement and coagulation cascades Regulation of actin cytoskeleton Prion disease Amoebiasis Coronavirus disease - COVID-19 Systemic lupus erythematosus		Terminal pathway of complement Regulation of Complement cascade

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
immunodeficiency	Immunodeficiency	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Atrophy	Stimulate	37020564
Breast Neoplasms	Associate	39199284
Fibrosis	Associate	37020564
Glomerulonephritis	Stimulate	37020564
Glomerulonephritis IGA	Associate	37020564
Lupus Erythematosus Systemic	Associate	36420131
Pain	Associate	34608709
Renal Insufficiency Chronic	Inhibit	32046176

C8G (complement C8 gamma chain)