Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7325
Gene name Gene Name - the full gene name approved by the HGNC.	Ubiquitin conjugating enzyme E2 E2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	UBE2E2
Synonyms (NCBI Gene) Gene synonyms aliases	UBCH8
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3p24.3

Show/Hide all(114)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045536	hsa-miR-149-5p	CLASH	23622248
MIRT045236	hsa-miR-186-5p	CLASH	23622248
MIRT1467423	hsa-miR-1207-5p	CLIP-seq
MIRT1467424	hsa-miR-128	CLIP-seq
MIRT1467425	hsa-miR-185	CLIP-seq
MIRT1467426	hsa-miR-3125	CLIP-seq
MIRT1467427	hsa-miR-3202	CLIP-seq
MIRT1467428	hsa-miR-3916	CLIP-seq
MIRT1467429	hsa-miR-4264	CLIP-seq
MIRT1467430	hsa-miR-4306	CLIP-seq
MIRT1467431	hsa-miR-4311	CLIP-seq
MIRT1467432	hsa-miR-4476	CLIP-seq
MIRT1467433	hsa-miR-4644	CLIP-seq
MIRT1467434	hsa-miR-4736	CLIP-seq
MIRT1467435	hsa-miR-4763-3p	CLIP-seq
MIRT1467436	hsa-miR-4796-3p	CLIP-seq
MIRT1467437	hsa-miR-4797-3p	CLIP-seq
MIRT1467438	hsa-miR-4797-5p	CLIP-seq
MIRT1467439	hsa-miR-548t	CLIP-seq
MIRT2140471	hsa-miR-132	CLIP-seq
MIRT2140472	hsa-miR-212	CLIP-seq
MIRT2140473	hsa-miR-3126-5p	CLIP-seq
MIRT2140474	hsa-miR-3182	CLIP-seq
MIRT2140475	hsa-miR-4709-5p	CLIP-seq
MIRT2140476	hsa-miR-4728-5p	CLIP-seq
MIRT2140477	hsa-miR-4734	CLIP-seq
MIRT1467423	hsa-miR-1207-5p	CLIP-seq
MIRT2361215	hsa-miR-1272	CLIP-seq
MIRT1467424	hsa-miR-128	CLIP-seq
MIRT2361216	hsa-miR-1322	CLIP-seq
MIRT2361217	hsa-miR-300	CLIP-seq
MIRT2361218	hsa-miR-3177-5p	CLIP-seq
MIRT2361219	hsa-miR-3613-3p	CLIP-seq
MIRT2361220	hsa-miR-369-3p	CLIP-seq
MIRT2361221	hsa-miR-374c	CLIP-seq
MIRT2361222	hsa-miR-381	CLIP-seq
MIRT2361223	hsa-miR-4461	CLIP-seq
MIRT2361224	hsa-miR-4658	CLIP-seq
MIRT2361225	hsa-miR-4691-3p	CLIP-seq
MIRT2361226	hsa-miR-4698	CLIP-seq
MIRT2361227	hsa-miR-4719	CLIP-seq
MIRT1467434	hsa-miR-4736	CLIP-seq
MIRT2361228	hsa-miR-4758-5p	CLIP-seq
MIRT1467435	hsa-miR-4763-3p	CLIP-seq
MIRT1467436	hsa-miR-4796-3p	CLIP-seq
MIRT2361229	hsa-miR-499-3p	CLIP-seq
MIRT2361230	hsa-miR-499a-3p	CLIP-seq
MIRT2361231	hsa-miR-520f	CLIP-seq
MIRT2361232	hsa-miR-522	CLIP-seq
MIRT1467439	hsa-miR-548t	CLIP-seq
MIRT2361233	hsa-miR-548u	CLIP-seq
MIRT2361234	hsa-miR-570	CLIP-seq
MIRT2361235	hsa-miR-640	CLIP-seq
MIRT2361236	hsa-miR-655	CLIP-seq
MIRT1467424	hsa-miR-128	CLIP-seq
MIRT2396579	hsa-miR-3157-5p	CLIP-seq
MIRT2396580	hsa-miR-361-5p	CLIP-seq
MIRT2361221	hsa-miR-374c	CLIP-seq
MIRT2361223	hsa-miR-4461	CLIP-seq
MIRT2361224	hsa-miR-4658	CLIP-seq
MIRT2361225	hsa-miR-4691-3p	CLIP-seq
MIRT2361228	hsa-miR-4758-5p	CLIP-seq
MIRT2361231	hsa-miR-520f	CLIP-seq
MIRT2361236	hsa-miR-655	CLIP-seq
MIRT2462780	hsa-miR-1197	CLIP-seq
MIRT2462781	hsa-miR-1226	CLIP-seq
MIRT2462782	hsa-miR-3158-3p	CLIP-seq
MIRT2462783	hsa-miR-4436a	CLIP-seq
MIRT2462784	hsa-miR-4446-3p	CLIP-seq
MIRT2462785	hsa-miR-4733-3p	CLIP-seq
MIRT2462786	hsa-miR-548v	CLIP-seq
MIRT2361215	hsa-miR-1272	CLIP-seq
MIRT2655044	hsa-miR-1297	CLIP-seq
MIRT2361216	hsa-miR-1322	CLIP-seq
MIRT2655045	hsa-miR-26a	CLIP-seq
MIRT2655046	hsa-miR-26b	CLIP-seq
MIRT2655047	hsa-miR-3065-5p	CLIP-seq
MIRT2655048	hsa-miR-3148	CLIP-seq
MIRT2655049	hsa-miR-3153	CLIP-seq
MIRT2655050	hsa-miR-3163	CLIP-seq
MIRT2655051	hsa-miR-3662	CLIP-seq
MIRT1467431	hsa-miR-4311	CLIP-seq
MIRT2655052	hsa-miR-4465	CLIP-seq
MIRT2655053	hsa-miR-4668-3p	CLIP-seq
MIRT2655054	hsa-miR-4668-5p	CLIP-seq
MIRT2655055	hsa-miR-4712-3p	CLIP-seq
MIRT2655056	hsa-miR-4733-5p	CLIP-seq
MIRT2655057	hsa-miR-4762-5p	CLIP-seq
MIRT2655058	hsa-miR-498	CLIP-seq
MIRT2655059	hsa-miR-548c-3p	CLIP-seq
MIRT2361234	hsa-miR-570	CLIP-seq
MIRT2655060	hsa-miR-577	CLIP-seq
MIRT2655061	hsa-miR-605	CLIP-seq
MIRT2462781	hsa-miR-1226	CLIP-seq
MIRT2361215	hsa-miR-1272	CLIP-seq
MIRT2655044	hsa-miR-1297	CLIP-seq
MIRT2361216	hsa-miR-1322	CLIP-seq
MIRT2655045	hsa-miR-26a	CLIP-seq
MIRT2655046	hsa-miR-26b	CLIP-seq
MIRT2655048	hsa-miR-3148	CLIP-seq
MIRT2655049	hsa-miR-3153	CLIP-seq
MIRT2462782	hsa-miR-3158-3p	CLIP-seq
MIRT2462784	hsa-miR-4446-3p	CLIP-seq
MIRT2655052	hsa-miR-4465	CLIP-seq
MIRT2655053	hsa-miR-4668-3p	CLIP-seq
MIRT2655054	hsa-miR-4668-5p	CLIP-seq
MIRT2462785	hsa-miR-4733-3p	CLIP-seq
MIRT2655056	hsa-miR-4733-5p	CLIP-seq
MIRT2655057	hsa-miR-4762-5p	CLIP-seq
MIRT2655058	hsa-miR-498	CLIP-seq
MIRT2655059	hsa-miR-548c-3p	CLIP-seq
MIRT2462786	hsa-miR-548v	CLIP-seq
MIRT2361234	hsa-miR-570	CLIP-seq
MIRT2655061	hsa-miR-605	CLIP-seq

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	20061386
GO:0005515	Function	Protein binding	IPI	17460044, 19549727, 21516116, 24446487, 25416956, 26752685, 28514442, 29892012, 31515488, 32296183, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0006513	Process	Protein monoubiquitination	IDA	27237050
GO:0006513	Process	Protein monoubiquitination	IEA
GO:0006974	Process	DNA damage response	IMP	21628527
GO:0010629	Process	Negative regulation of gene expression	IDA	39096901
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032020	Process	ISG15-protein conjugation	IBA
GO:0032020	Process	ISG15-protein conjugation	IDA	16428300
GO:0042296	Function	ISG15 transferase activity	IBA
GO:0042296	Function	ISG15 transferase activity	IDA	16428300
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IBA
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IDA	9371400, 21628527, 27237050
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IEA
GO:0070534	Process	Protein K63-linked ubiquitination	IBA
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	20061386
GO:0070936	Process	Protein K48-linked ubiquitination	IBA
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	20061386
GO:0070936	Process	Protein K48-linked ubiquitination	IEA
GO:0070979	Process	Protein K11-linked ubiquitination	IBA
GO:0070979	Process	Protein K11-linked ubiquitination	IDA	20061386
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IGI	21628527

MIM	HGNC	e!Ensembl
602163	12478	ENSG00000182247

Protein

UniProt ID

Q96LR5

Protein name

Ubiquitin-conjugating enzyme E2 E2 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme E2) (UbcH8) (Ubiquitin carrier protein E2) (Ubiquitin-protein ligase E2)

Protein function

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. Catalyzes the ISGylation of influenza A virus NS1 protein.

PDB

1Y6L , 6W9A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00179	UQ_con	59 → 196	Ubiquitin-conjugating enzyme	Domain

Sequence

MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRI
QKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPK
VTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQ
YMTNRAEHDRMARQWTKRYAT

Sequence length

201

Interactions

View interactions

	KEGG		Reactome
	Ubiquitin mediated proteolysis		Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Unknown Diseases (7)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Asthma	N/A	N/A	GWAS
Diabetes	Type 2 diabetes, Type 2 diabetes or prostate cancer (pleiotropy), Type 2 diabetes (PheCode 250.2), Diabetes	N/A	N/A	GWAS
Eczema	Eczema	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS
Vitiligo	Vitiligo	N/A	N/A	GWAS

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	22491060
Carcinoma Squamous Cell	Associate	22491060
Charcot Marie Tooth Disease Dominant Intermediate B	Associate	27175665
Diabetes Gestational	Associate	23862583
Diabetes Mellitus	Associate	27281273
Diabetes Mellitus Type 2	Associate	26020062, 27175665, 27655316, 35456451
Insulin Resistance	Associate	26020062
Neoplasm Metastasis	Associate	22491060
Neoplasms	Associate	22491060

UBE2E2 (ubiquitin conjugating enzyme E2 E2)