HSP90AA5P (heat shock protein 90 alpha family class A member 5, pseudogene)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 730211
Gene name Heat shock protein 90 alpha family class A member 5, pseudogene
Gene symbol HSP90AA5P
Synonyms (NCBI Gene)
HSP90Ae
Chromosome 3
Chromosome location 3q27.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
Gene Gene ontology Other IDs Protein
Show/Hide all (8)
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0005515 Function Protein binding IPI 28514442, 33961781
GO:0005524 Function ATP binding IEA
GO:0005737 Component Cytoplasm IEA
GO:0006457 Process Protein folding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
HGNC 32535 N/A
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q58FG0
Protein name Putative heat shock protein HSP 90-alpha A5 (Heat shock protein 90-alpha E) (Heat shock protein 90Ae)
Protein function Putative molecular chaperone that may promote the maturation, structural maintenance and proper regulation of specific target proteins.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00183 HSP90 26 → 164 Hsp90 protein Family
PF00183 HSP90 159 → 280 Hsp90 protein Family
Sequence 
MGFHHVGQAGLELLTSGHPALERRPEYLEERRIKEIVKKHSQFIGYPITLFVEKKRNKQV
SDAEAEKKEDKRKKKKESNDKPEIEDVGSDEEEEKKDADKKKKKSKEKYIDQELNKTKPI
WTRNPDAITNEEYGEFHQSLTNNWEDHLAVKHFSVEGQLEELKDSRRVMKANQKHIYYIT
GETKDQVANSAFVECLQKHGLEVIYMIELIDKYCVQQLKELESKTVVSVAKEGLELPEDE
EEKKKQEEKKTKFENLCKIMKDMLEKKVKKVVVSNCMEDPQRHTNKIYRMIKLGLGVDEY
DPTANDINAAITKEMPPLRGGDDTSRMEEVGGSG
Sequence length 334
Interactions View interactions