Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
730
Gene name Gene Name - the full gene name approved by the HGNC.
Complement C7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
C7
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5p13.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a serum glycoprotein that forms a membrane attack complex together with complement components C5b, C6, C8, and C9 as part of the terminal complement pathway of the innate immune system. The protein encoded by this gene contains a cholest
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121964920 C>A,T Pathogenic Coding sequence variant, missense variant
rs121964921 G>A,C,T Pathogenic Coding sequence variant, missense variant
rs121964922 T>A Pathogenic Stop gained, coding sequence variant
rs139491301 T>- Likely-pathogenic Coding sequence variant, frameshift variant
rs201240159 T>C Pathogenic Splice donor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT852027 hsa-miR-1206 CLIP-seq
MIRT852028 hsa-miR-1253 CLIP-seq
MIRT852029 hsa-miR-1268 CLIP-seq
MIRT852030 hsa-miR-1268b CLIP-seq
MIRT852031 hsa-miR-1285 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
GO:0005579 Component Membrane attack complex IBA
GO:0005579 Component Membrane attack complex IDA 22832194, 26841837, 27052168, 30552328, 30643019, 31061395, 32569291, 36797260
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
217070 1346 ENSG00000112936
Protein
UniProt ID P10643
Protein name Complement component C7
Protein function Component of the membrane attack complex (MAC), a multiprotein complex activated by the complement cascade, which inserts into a target cell membrane and forms a pore, leading to target cell membrane rupture and cell lysis (PubMed:22832194, PubM
PDB 2WCY , 6H03 , 6H04 , 7NYC , 7NYD , 8B0F , 8B0G , 8B0H
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00090 TSP_1 33 79 Thrombospondin type 1 domain Domain
PF00057 Ldl_recept_a 83 119 Low-density lipoprotein receptor domain class A Repeat
PF01823 MACPF 227 448 MAC/Perforin domain Domain
PF00090 TSP_1 501 549 Thrombospondin type 1 domain Domain
PF00084 Sushi 571 626 Sushi repeat (SCR repeat) Domain
PF00084 Sushi 631 688 Sushi repeat (SCR repeat) Domain
PF18434 Kazal_3 791 838 Kazal-type serine protease inhibitor domain Domain
Sequence
MKVISLFILVGFIGEFQSFSSASSPVNCQWDFYAPWSECNGCTKTQTRRRSVAVYGQYGG
QPCVGNAFETQSCEPTRGC
PTEEGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCE
DSERRPSCDIDKPPPNIELTGNGYNELTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLS
GNVLSYTFQVKINNDFNYEFYNSTWSYVKHTSTEHTSSSRKRSFFRSSSSSSRSYTSHTN
EIHKGKSYQLLVVENTVEVAQFINNNPEFLQLAEPFWKELSHLPSLYDYSAYRRLIDQYG
THYLQSGSLGGEYRVLFYVDSEKLKQNDFNSVEEKKCKSSGWHFVVKFSSHGCKELENAL
KAASGTQNNVLRGEPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQK
LTPLYELVKEVPCASVKKLYLKWALEEY
LDEFDPCHCRPCQNGGLATVEGTHCLCHCKPY
TFGAACEQGVLVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETT
ESTQCEDEE
LEHLRLLEPHCFPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCN
EGYSLIGNPVARCGEDLRWLVGEMHC
QKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCS
GGMSLEGPSAFLCGSSLKWSPEMKNARC
VQKENPLTQAVPKCQRWEKLQNSRCVCKMPYE
CGPSLDVCAQDERSKRILPLTVCKMHVLHCQGRNYTLTGRDSCTLPASAEKACGACPLWG
KCDAESSKCVCREASECEEEGFSICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAA
ETQ
Sequence length 843
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Complement and coagulation cascades
Regulation of actin cytoskeleton
Prion disease
Coronavirus disease - COVID-19
Systemic lupus erythematosus
  Terminal pathway of complement
Regulation of Complement cascade
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Complement Component Deficiency complement component 7 deficiency rs1579848888, rs779723422, rs770367814, rs387906509, rs1467298230, rs1022194067, rs774370086, rs121964922, rs531103546, rs764871530, rs139491301 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Bacterial Infections Associate 27063552
Carcinoma Hepatocellular Associate 31341412, 33964921
Cholangiocarcinoma Associate 35589822
Fibrosis Stimulate 31860081
Glaucoma Open Angle Associate 23536807
Liver Failure Associate 31860081
Meningococcal Infections Associate 8774358
Neoplasms Inhibit 27852032
Non alcoholic Fatty Liver Disease Stimulate 31860081
Otitis Media Associate 8774358