SHISA9 (shisa family member 9)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
729993
Gene name Gene Name - the full gene name approved by the HGNC.
Shisa family member 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SHISA9
Synonyms (NCBI Gene) Gene synonyms aliases
CKAMP44
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p13.12
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1194)
miRTarBase ID miRNA Experiments Reference
MIRT570790 hsa-miR-3662 HITS-CLIP 23313552
MIRT570791 hsa-miR-8084 HITS-CLIP 23313552
MIRT699616 hsa-miR-7153-3p HITS-CLIP 23313552
MIRT570789 hsa-miR-1272 HITS-CLIP 23313552
MIRT699615 hsa-miR-4789-5p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(21)
GO ID Ontology Definition Evidence Reference
GO:0005886 Component Plasma membrane IEA
GO:0008328 Component Ionotropic glutamate receptor complex IEA
GO:0008328 Component Ionotropic glutamate receptor complex ISS
GO:0014069 Component Postsynaptic density IBA
GO:0016020 Component Membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
613346 37231 ENSG00000237515
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID B4DS77
Protein name Protein shisa-9
Protein function Regulator of short-term neuronal synaptic plasticity in the dentate gyrus. Associates with AMPA receptors (ionotropic glutamate receptors) in synaptic spines and promotes AMPA receptor desensitization at excitatory synapses (By similarity). {ECO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13908 Shisa 71 → 260 Wnt and FGF inhibitory regulator Family
Sequence 
MRRVLRLLLGCFLTELCARVCRAQERAGHGQLAQLGGVLLLAGGNRSGAASGEASEGAEA
SDAPPTRAPTPDFCRGYFDVMGQWDPPFNCSSGDFIFCCGTCGFRFCCTFKKRRLNQSTC
TNYDTPLWLNTGKPPARKDDPLHDPTKDKTNLIVYIICGVVAVMVLVGIFTKLGLEKAHR
PQREHMSRALADVMRPQGHCNTDHMERDLNIVVHVQHYENMDTRTPINNLHATQMNNAVP
TSPLLQQMGHPHSYPNLGQISNPYEQQPPGKELNKYASLKAVGSSDGDWAVSTLKSPKAD
KVNDDFYTKRRHLAELAAKGNLPLHPVRVEDEPRAFSPEHGPAKQNGQKSRTNKMPPHPL
AYTSTTNFKGWDPNEQSLRRQAYSNKGKLGTAETGSSDPLGTRPQHYPPPQPYFITNSKT
EVTV
Sequence length 424
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (7)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Mental Depression Major depressive disorder N/A N/A GWAS
Neuroticism Neuroticism N/A N/A GWAS
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Show/Hide Text Mining Associations (3)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 35865652
Carcinoma Pancreatic Ductal Associate 33593879
Muscular Atrophy Spinal Associate 19396477