MORN2 (MORN repeat containing 2)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 729967
Gene name MORN repeat containing 2
Gene symbol MORN2
Synonyms (NCBI Gene)
BLOCK27MOPT
Chromosome 2
Chromosome location 2p22.1
miRNA miRNA information provided by mirtarbase database.
11
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (11)
miRTarBase ID miRNA Experiments Reference
MIRT048107 hsa-miR-197-3p CLASH 23622248
MIRT1155632 hsa-miR-142-3p CLIP-seq
MIRT1155633 hsa-miR-3124-3p CLIP-seq
MIRT1155634 hsa-miR-3160-5p CLIP-seq
MIRT1155635 hsa-miR-3671 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (6)
GO ID Ontology Definition Evidence Reference
GO:0001669 Component Acrosomal vesicle IEA
GO:0005515 Function Protein binding IPI 25416956
GO:0005634 Component Nucleus IEA
GO:0007283 Process Spermatogenesis IEA
GO:0030154 Process Cell differentiation IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q502X0
Protein name MORN repeat-containing protein 2 (MORN motif protein in testis)
Protein function Might have a role in spermatogenesis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02493 MORN 15 → 37 MORN repeat Repeat
PF02493 MORN 38 → 59 MORN repeat Repeat
Sequence 
MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLE
WSGNFHFTAAPDLKLKLHM
Sequence length 79
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
AMYOTROPHIC LATERAL SCLEROSIS — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (2)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Leukemia Myelogenous Chronic BCR ABL Positive Associate 26822197
★★★★★
★☆☆☆☆
Found in Text Mining only
Neoplasms Associate 26822197
★★★★★
★☆☆☆☆
Found in Text Mining only