Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7297
Gene name Gene Name - the full gene name approved by the HGNC.	Tyrosine kinase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TYK2
Synonyms (NCBI Gene) Gene synonyms aliases	IMD35, JTK1
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the tyrosine kinase and, more specifically, the Janus kinases (JAKs) protein families. This protein associates with the cytoplasmic domain of type I and type II cytokine receptors and promulgate cytokine signals by phosphoryl

Show/Hide all(16)

SNP ID	Visualize variation	Clinical significance	Consequence
rs2304258	C>T	Uncertain-significance, risk-factor	Upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs2304259	T>G	Uncertain-significance, risk-factor	Upstream transcript variant
rs17000728	C>T	Uncertain-significance, risk-factor	Upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs17000730	T>C	Uncertain-significance, risk-factor	Upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs144960992	A>G	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, genic upstream transcript variant, non coding transcript variant, upstream transcript variant, coding sequence variant
rs201025290	G>A,C	Pathogenic	Missense variant, coding sequence variant, stop gained, non coding transcript variant
rs770927552	CAAG>-	Pathogenic	5 prime UTR variant, genic upstream transcript variant, frameshift variant, coding sequence variant, non coding transcript variant
rs775578531	T>C	Likely-pathogenic	Splice acceptor variant, non coding transcript variant, genic downstream transcript variant
rs779037308	G>A,C	Likely-pathogenic	Stop gained, missense variant, coding sequence variant, genic downstream transcript variant, non coding transcript variant
rs869320745	CCTCCCTGG>-	Pathogenic	Inframe indel, stop gained, coding sequence variant, non coding transcript variant
rs879253731	C>A	Pathogenic	Stop gained, genic upstream transcript variant, coding sequence variant, non coding transcript variant
rs879253732	G>-	Pathogenic	Frameshift variant, genic upstream transcript variant, coding sequence variant, 5 prime UTR variant, non coding transcript variant
rs891696485	A>C,T	Risk-factor, uncertain-significance	Upstream transcript variant
rs953883300	C>T	Uncertain-significance, risk-factor	Upstream transcript variant
rs1555719963	G>-	Likely-pathogenic	Upstream transcript variant, non coding transcript variant, coding sequence variant, genic upstream transcript variant, frameshift variant
rs1599328119	C>T	Likely-pathogenic	Non coding transcript variant, splice acceptor variant, genic downstream transcript variant

Show/Hide all(62)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023017	hsa-miR-124-3p	Microarray	18668037
MIRT1465602	hsa-miR-124	CLIP-seq
MIRT1465603	hsa-miR-1251	CLIP-seq
MIRT1465604	hsa-miR-1262	CLIP-seq
MIRT1465605	hsa-miR-1270	CLIP-seq
MIRT1465606	hsa-miR-1273f	CLIP-seq
MIRT1465607	hsa-miR-27a	CLIP-seq
MIRT1465608	hsa-miR-27b	CLIP-seq
MIRT1465609	hsa-miR-2861	CLIP-seq
MIRT1465610	hsa-miR-3165	CLIP-seq
MIRT1465611	hsa-miR-3714	CLIP-seq
MIRT1465612	hsa-miR-3910	CLIP-seq
MIRT1465613	hsa-miR-4257	CLIP-seq
MIRT1465614	hsa-miR-4305	CLIP-seq
MIRT1465615	hsa-miR-4433	CLIP-seq
MIRT1465616	hsa-miR-4683	CLIP-seq
MIRT1465617	hsa-miR-4701-3p	CLIP-seq
MIRT1465618	hsa-miR-506	CLIP-seq
MIRT1465619	hsa-miR-513a-5p	CLIP-seq
MIRT1465620	hsa-miR-541	CLIP-seq
MIRT1465621	hsa-miR-615-5p	CLIP-seq
MIRT1465622	hsa-miR-620	CLIP-seq
MIRT1465623	hsa-miR-654-5p	CLIP-seq
MIRT1921001	hsa-miR-3690	CLIP-seq
MIRT1921002	hsa-miR-4254	CLIP-seq
MIRT1921003	hsa-miR-4270	CLIP-seq
MIRT1921004	hsa-miR-4441	CLIP-seq
MIRT1921005	hsa-miR-4793-5p	CLIP-seq
MIRT1921001	hsa-miR-3690	CLIP-seq
MIRT1921002	hsa-miR-4254	CLIP-seq
MIRT1921003	hsa-miR-4270	CLIP-seq
MIRT1921004	hsa-miR-4441	CLIP-seq
MIRT1921005	hsa-miR-4793-5p	CLIP-seq
MIRT1921001	hsa-miR-3690	CLIP-seq
MIRT1921002	hsa-miR-4254	CLIP-seq
MIRT1921003	hsa-miR-4270	CLIP-seq
MIRT1921004	hsa-miR-4441	CLIP-seq
MIRT1921005	hsa-miR-4793-5p	CLIP-seq
MIRT1465602	hsa-miR-124	CLIP-seq
MIRT1465604	hsa-miR-1262	CLIP-seq
MIRT2360637	hsa-miR-1283	CLIP-seq
MIRT2360638	hsa-miR-1287	CLIP-seq
MIRT2360639	hsa-miR-3652	CLIP-seq
MIRT2360640	hsa-miR-371-3p	CLIP-seq
MIRT1465611	hsa-miR-3714	CLIP-seq
MIRT2360641	hsa-miR-371b-3p	CLIP-seq
MIRT1465612	hsa-miR-3910	CLIP-seq
MIRT2360642	hsa-miR-409-3p	CLIP-seq
MIRT2360643	hsa-miR-4430	CLIP-seq
MIRT2360644	hsa-miR-4446-3p	CLIP-seq
MIRT2360645	hsa-miR-4473	CLIP-seq
MIRT2360646	hsa-miR-4477b	CLIP-seq
MIRT2360647	hsa-miR-4492	CLIP-seq
MIRT2360648	hsa-miR-4498	CLIP-seq
MIRT2360649	hsa-miR-4671-3p	CLIP-seq
MIRT1465617	hsa-miR-4701-3p	CLIP-seq
MIRT2360650	hsa-miR-4710	CLIP-seq
MIRT2360651	hsa-miR-4749-3p	CLIP-seq
MIRT1465618	hsa-miR-506	CLIP-seq
MIRT2360652	hsa-miR-515-3p	CLIP-seq
MIRT2360653	hsa-miR-519e	CLIP-seq
MIRT2360654	hsa-miR-762	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
STAT3	Repression	18550668

Show/Hide all(70)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	EXP	1386289, 8232552
GO:0004713	Function	Protein tyrosine kinase activity	IC	7543512
GO:0004713	Function	Protein tyrosine kinase activity	IDA	10542297
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	TAS	7528775
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IDA	7526154, 7657660, 8232552, 8605876
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	TAS	2216457, 8232552
GO:0005131	Function	Growth hormone receptor binding	IBA
GO:0005131	Function	Growth hormone receptor binding	IPI	10502458
GO:0005515	Function	Protein binding	IPI	21516116, 22939624, 24704786, 25416956, 26175413, 29892012, 32296183, 32953130
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	10502458
GO:0005737	Component	Cytoplasm	IDA	10502458
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IPI	11114383
GO:0005886	Component	Plasma membrane	TAS	34813358
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	9020188, 28753426
GO:0006468	Process	Protein phosphorylation	TAS	2216457
GO:0006955	Process	Immune response	NAS	19088061
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	7526154, 7657660, 7759950, 8605876, 23139419, 28753426
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	7526154, 7657660, 8232552, 8605876
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	TAS	8232552
GO:0008283	Process	Cell population proliferation	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IC	7528775
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019897	Component	Extrinsic component of plasma membrane	TAS	34813358
GO:0022407	Process	Regulation of cell-cell adhesion	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IC	7543512
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IDA	12023369, 19088061
GO:0032740	Process	Positive regulation of interleukin-17 production	NAS	16482511
GO:0032819	Process	Positive regulation of natural killer cell proliferation	IDA	19088061
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035722	Process	Interleukin-12-mediated signaling pathway	IDA	7528775
GO:0038155	Process	Interleukin-23-mediated signaling pathway	IDA	7528775
GO:0038196	Process	Type III interferon-mediated signaling pathway	NAS	30936491
GO:0042022	Component	Interleukin-12 receptor complex	IPI	39111304
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	11114383
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0043235	Component	Receptor complex	IPI	21854986
GO:0046425	Process	Regulation of receptor signaling pathway via JAK-STAT	IEA
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IDA	7638186, 12023369
GO:0046634	Process	Regulation of alpha-beta T cell activation	IEA
GO:0051142	Process	Positive regulation of NK T cell proliferation	IDA	19088061
GO:0051142	Process	Positive regulation of NK T cell proliferation	NAS	19088061
GO:0060333	Process	Type II interferon-mediated signaling pathway	IDA	8232552
GO:0060337	Process	Type I interferon-mediated signaling pathway	IDA	8232552
GO:0060337	Process	Type I interferon-mediated signaling pathway	NAS	30936491
GO:0060337	Process	Type I interferon-mediated signaling pathway	TAS
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IBA
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0072536	Component	Interleukin-23 receptor complex	IPI	12023369
GO:0098586	Process	Cellular response to virus	NAS	30936491
GO:0140105	Process	Interleukin-10-mediated signaling pathway	IDA	7543512
GO:1900182	Process	Positive regulation of protein localization to nucleus	IDA	8605876, 26479788
GO:1900182	Process	Positive regulation of protein localization to nucleus	IDA	8605876, 26479788
GO:2000318	Process	Positive regulation of T-helper 17 type immune response	NAS	16482511

MIM	HGNC	e!Ensembl
176941	12440	ENSG00000105397

Protein

UniProt ID

P29597

Protein name

Non-receptor tyrosine-protein kinase TYK2 (EC 2.7.10.2)

Protein function

Tyrosine kinase of the non-receptor type involved in numerous cytokines and interferons signaling, which regulates cell growth, development, cell migration, innate and adaptive immunity (PubMed:10542297, PubMed:10995743, PubMed:7657660, PubMed:7

PDB

3LXN , 3LXP , 3NYX , 3NZ0 , 3ZON , 4GFO , 4GIH , 4GII , 4GJ2 , 4GJ3 , 4GVJ , 4OLI , 4PO6 , 4PY1 , 4WOV , 5C01 , 5C03 , 5F1Z , 5F20 , 5TKD , 5WAL , 6AAM , 6DBK , 6DBM , 6NSL , 6NZE , 6NZF , 6NZH , 6NZP , 6NZQ , 6NZR , 6OVA , 6VNS , 6VNV , 6VNX , 6VNY , 6X8F , 6X8G , 7AX4 , 7K7O , 7K7Q , 7UYR , 7UYS , 7UYT , 7UYU , 8EXN , 8EYC , 8S98 , 8S99 , 8S9A , 8TB5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18379	FERM_F1	28 → 125	FERM F1 ubiquitin-like domain	Domain
PF18377	FERM_F2	141 → 266	FERM F2 acyl-CoA binding protein-like domain	Domain
PF17887	Jak1_Phl	285 → 432	Jak1 pleckstrin homology-like domain	Domain
PF07714	PK_Tyr_Ser-Thr	589 → 866	Protein tyrosine and serine/threonine kinase	Domain
PF07714	PK_Tyr_Ser-Thr	897 → 1169	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Observed in all cell lines analyzed. Expressed in a variety of lymphoid and non-lymphoid cell lines. {ECO:0000269|PubMed:2156206}.

Sequence

MPLRHWGMARGSKPVGDGAQPMAAMGGLKVLLHWAGPGGGEPWVTFSESSLTAEEVCIHI
AHKVGITPPCFNLFALFDAQAQVWLPPNHILEIPRDASLMLYFRIRFYFRNWHGMNPREP
AVYRCGPPGTEASSDQTAQGMQLLDPASFEYLFEQGKHEFVNDVASLWELSTEEEIHHFK
NESLGMAFLHLCHLALRHGIPLEEVAKKTSFKDCIPRSFRRHIRQHSALTRLRLRNVFRR
FLRDFQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGEPCYIRDSGVAP
TDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHK
AVGQPADRPREPLWAYFCDFRDITHVVLKEHCVSIHRQDNKCLELSLPSRAAALSFVSLV
DGYFRLTADSSHYLCHEVAPPRLVMSIRDGIHGPLLEPFVQAKLRPEDGLYLIHWSTSHP
YRLILTVAQRSQAPDGMQSLRLRKFPIEQQDGAFVLEGWGRSFPSVRELGAALQGCLLRA
GDDCFSLRRCCLPQPGETSNLIIMRGARASPRTLNLSQLSFHRVDQKEITQLSHLGQGTR
TNVYEGRLRVEGSGDPEEGKMDDEDPLVPGRDRGQELRVVLKVLDPSHHDIALAFYETAS
LMSQVSHTHLAFVHGVCVRGPENIMVTEYVEHGPLDVWLRRERGHVPMAWKMVVAQQLAS
ALSYLENKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSREERVERIPWLA
PECLPGGANSLSTAMDKWGFGATLLEICFDGEAPLQSRSPSEKEHFYQRQHRLPEPSCPQ
LATLTSQCLTYEPTQRPSFRTILRDLTRLQPHNLADVLTVNPDSPASDPTVFHKRYLKKI
RDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHII
KYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYI
HRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYY
ASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKC
PCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC

Sequence length

1187

Interactions

View interactions

	KEGG		Reactome
	Necroptosis Osteoclast differentiation Toll-like receptor signaling pathway NOD-like receptor signaling pathway JAK-STAT signaling pathway Th1 and Th2 cell differentiation Th17 cell differentiation Toxoplasmosis Hepatitis C Hepatitis B Measles Influenza A Human papillomavirus infection Kaposi sarcoma-associated herpesvirus infection Herpes simplex virus 1 infection Epstein-Barr virus infection Coronavirus disease - COVID-19		Interleukin-6 signaling MAPK3 (ERK1) activation MAPK1 (ERK2) activation Other interleukin signaling Interleukin-10 signaling Interleukin-4 and Interleukin-13 signaling IL-6-type cytokine receptor ligand interactions Interleukin-20 family signaling Interleukin-35 Signalling Interleukin-12 signaling Interleukin-23 signaling Interleukin-27 signaling Interferon alpha/beta signaling Regulation of IFNA signaling

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Immunodeficiency	Immunodeficiency 35	rs201025290, rs770927552, rs1555719963, rs775578531, rs869320745, rs879253731, rs879253732	N/A

Show/Hide Unknown Diseases (13)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Biliary Cholangitis	Primary biliary cholangitis	N/A	N/A	GWAS
Biliary Cirrhosis	Primary biliary cirrhosis	N/A	N/A	GWAS
Crohn Disease	Crohn's disease	N/A	N/A	GWAS
Diabetes	Type 1 diabetes	N/A	N/A	GWAS
Hypothyroidism	Hypothyroidism	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease	N/A	N/A	GWAS
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS
Psoriasis	Psoriasis	N/A	N/A	GWAS
Psoriasis vulgaris	Psoriasis vulgaris	N/A	N/A	GWAS
Rheumatoid arthritis	Rheumatoid arthritis	N/A	N/A	GWAS
Sarcoidosis	Sarcoidosis	N/A	N/A	GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus	N/A	N/A	GWAS
Ulcerative colitis	Ulcerative colitis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (90)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acne Vulgaris	Associate	29091937
Acute erythroleukemia	Associate	10340405
Adenoma Pleomorphic	Associate	27286739
Alopecia Areata	Associate	34863853
Alzheimer Disease	Associate	30478411
Arthritis Juvenile	Associate	28990043
Arthritis Psoriatic	Associate	22298274, 39684939
Arthritis Rheumatoid	Associate	25849893, 33583939, 35470158
Autoimmune Diseases	Associate	16239216, 25849893, 31961910, 33542028, 33583939, 34225445, 35482673, 35711568
Breast Neoplasms	Associate	17934210, 22116632, 25104439
Carcinoma Hepatocellular	Associate	31418417, 31485610
Carcinoma Renal Cell	Associate	17573897, 17898043
Cognitive Dysfunction	Associate	30478411
Colitis Associated Neoplasms	Associate	36232773
Colitis Ulcerative	Associate	36232773, 38102678
Colonic Neoplasms	Associate	8530527
Colorectal Neoplasms	Associate	22121102, 25541970, 29641532
COVID 19	Associate	33542028, 34823125, 35212764, 35339044, 35842705, 36292769, 36327221, 36672770, 36959416, 37020259, 38102678, 39237611
Critical Illness	Associate	33307546
Crohn Disease	Associate	19249008
Dermatitis Atopic	Associate	17088085, 39684939
Diabetes Mellitus	Associate	26288847, 28826655, 33799705
Diabetes Mellitus Type 1	Associate	19966805, 26288847, 28826655, 32476252, 33799705, 34225445, 34858326, 36289205
Diabetes Mellitus Type 1	Inhibit	37854597
Diabetes Mellitus Type 2	Associate	26288847, 33799705
Down Syndrome	Associate	27472900
Epstein Barr Virus Infections	Associate	29725107, 31961910
Fibrosarcoma	Associate	7537214, 9305869, 9794795
Gastrointestinal Neoplasms	Associate	38102678
Head and Neck Neoplasms	Associate	35711568
Hepatitis C Chronic	Associate	28704535
Immune System Diseases	Associate	29304122
Inflammation	Associate	25652333, 31356157, 32476252, 34225445, 37229810, 37588593, 37854597
Inflammatory Bowel Diseases	Associate	25849893, 38102678
Influenza Human	Associate	26288847, 28826655
Insulin Resistance	Associate	33799705
Interferon gamma receptor 1 deficiency	Associate	35708626
Invasive Pneumococcal Disease Recurrent Isolated 2	Associate	36094518
Job Syndrome	Associate	17088085, 21300911, 28826655, 29725107
Leprosy	Associate	28842327
Leukemia Biphenotypic Acute	Associate	33260630
Leukemia Myeloid Acute	Associate	18270328, 31350825
Liver Cirrhosis Biliary	Associate	22961000
Lung Neoplasms	Associate	24833526
Lupus Erythematosus Cutaneous	Associate	19758313
Lupus Erythematosus Discoid	Associate	19758313
Lupus Erythematosus Systemic	Associate	15657875, 19442287, 19966805, 22046141, 25849893, 29059182, 29475858, 30777133, 31434951, 34419106, 35482673, 36327221
Lymphohistiocytosis Hemophagocytic	Associate	38183241
Lymphoma	Associate	25349176, 29504848
Lymphoma B Cell	Associate	29725107
Lymphopenia	Associate	29725107
Lymphoproliferative Disorders	Associate	25349176
Melanoma Cutaneous Malignant	Associate	29641532
Microphthalmia Isolated 1	Associate	36094518
Multiple Sclerosis	Associate	19293837, 19865102, 19888296, 19966805, 22744673
Multiple Trauma	Associate	40446056
Mycobacterium Infections Nontuberculous	Associate	31961910
Nasopharyngeal Carcinoma	Associate	37023940
Neoplasm Metastasis	Associate	22116632, 34449498, 37023940
Neoplasm Metastasis	Stimulate	33083484
Neoplasms	Associate	16239216, 24833526, 29641532, 33260630, 34449498, 35711568, 35874683
Neoplasms Squamous Cell	Associate	34449498
Nephrotic Syndrome	Associate	22252769
Neurofibrosarcoma	Associate	27875628
Non alcoholic Fatty Liver Disease	Stimulate	25747354
Obesity	Inhibit	25747354
Personality Disorders	Associate	31418417
Pneumonia	Associate	35212764
Polycythemia Vera	Associate	16239216
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	26265185
Primary Immunodeficiency Diseases	Associate	26162572, 29725107
Prostatic Neoplasms	Associate	10660600, 29641532
Prostatitis	Associate	10660600, 8650201
Psoriasis	Associate	22298274, 26613086, 31972249, 35482673, 39684939
Rectal Neoplasms	Associate	22121102
Respiratory Tract Infections	Associate	35212764
Scleroderma Systemic	Associate	34248934, 39684939
Sezary Syndrome	Associate	27039262
Sjogren's Syndrome	Associate	29504848, 35896530
Squamous Cell Carcinoma of Head and Neck	Stimulate	35711568
Stomach Neoplasms	Associate	32993565
Stomach Neoplasms	Stimulate	33083484
Streptococcal Infections	Associate	29091937
Tertiary Lymphoid Structures	Associate	34449498
Tuberculosis	Associate	31068474
Tyrosine Kinase 2 Deficiency	Inhibit	29725107
Tyrosine Kinase 2 Deficiency	Associate	29725107, 36094518
Uveitis	Associate	33503442
Uveitis Posterior	Associate	32707200
Virus Diseases	Associate	36094518

TYK2 (tyrosine kinase 2)