Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	7295
Gene name	Thioredoxin
Gene symbol	TXN
Synonyms (NCBI Gene)	TRDXTRXTRX1TXN1Trx80
Chromosome	9
Chromosome location	9q31.3
Summary	The protein encoded by this gene acts as a homodimer and is involved in many redox reactions. The encoded protein is active in the reversible S-nitrosylation of cysteines in certain proteins, which is part of the response to intracellular nitric oxide. Th

Show/Hide all (52)

miRTarBase ID	miRNA	Experiments	Reference
MIRT046747	hsa-miR-222-3p	CLASH	23622248
MIRT045602	hsa-miR-149-5p	CLASH	23622248
MIRT035966	hsa-miR-1301-3p	CLASH	23622248
MIRT441782	hsa-miR-3121-3p	PAR-CLIP	22100165
MIRT441781	hsa-miR-6882-5p	PAR-CLIP	22100165
MIRT441780	hsa-miR-889-5p	PAR-CLIP	22100165
MIRT441779	hsa-miR-4662a-5p	PAR-CLIP	22100165
MIRT441782	hsa-miR-3121-3p	PAR-CLIP	22100165
MIRT441781	hsa-miR-6882-5p	PAR-CLIP	22100165
MIRT441780	hsa-miR-889-5p	PAR-CLIP	22100165
MIRT441779	hsa-miR-4662a-5p	PAR-CLIP	22100165
MIRT441782	hsa-miR-3121-3p	PAR-CLIP	22100165
MIRT441781	hsa-miR-6882-5p	PAR-CLIP	22100165
MIRT441780	hsa-miR-889-5p	PAR-CLIP	22100165
MIRT441779	hsa-miR-4662a-5p	PAR-CLIP	22100165
MIRT441782	hsa-miR-3121-3p	PAR-CLIP	22100165
MIRT441781	hsa-miR-6882-5p	PAR-CLIP	22100165
MIRT441780	hsa-miR-889-5p	PAR-CLIP	22100165
MIRT441779	hsa-miR-4662a-5p	PAR-CLIP	22100165
MIRT1464895	hsa-miR-1279	CLIP-seq
MIRT1464896	hsa-miR-409-3p	CLIP-seq
MIRT1464897	hsa-miR-4307	CLIP-seq
MIRT1464898	hsa-miR-629	CLIP-seq
MIRT1464899	hsa-miR-654-3p	CLIP-seq
MIRT1464895	hsa-miR-1279	CLIP-seq
MIRT1464896	hsa-miR-409-3p	CLIP-seq
MIRT1464897	hsa-miR-4307	CLIP-seq
MIRT1464898	hsa-miR-629	CLIP-seq
MIRT1464899	hsa-miR-654-3p	CLIP-seq
MIRT1464895	hsa-miR-1279	CLIP-seq
MIRT1464896	hsa-miR-409-3p	CLIP-seq
MIRT1464897	hsa-miR-4307	CLIP-seq
MIRT1464898	hsa-miR-629	CLIP-seq
MIRT1464899	hsa-miR-654-3p	CLIP-seq
MIRT1464898	hsa-miR-629	CLIP-seq
MIRT1464899	hsa-miR-654-3p	CLIP-seq
MIRT1464895	hsa-miR-1279	CLIP-seq
MIRT1464898	hsa-miR-629	CLIP-seq
MIRT1464899	hsa-miR-654-3p	CLIP-seq
MIRT1464895	hsa-miR-1279	CLIP-seq
MIRT2653928	hsa-miR-3652	CLIP-seq
MIRT2653929	hsa-miR-3942-3p	CLIP-seq
MIRT2653930	hsa-miR-4430	CLIP-seq
MIRT2653931	hsa-miR-4505	CLIP-seq
MIRT1464898	hsa-miR-629	CLIP-seq
MIRT1464899	hsa-miR-654-3p	CLIP-seq
MIRT1464895	hsa-miR-1279	CLIP-seq
MIRT2653928	hsa-miR-3652	CLIP-seq
MIRT2653930	hsa-miR-4430	CLIP-seq
MIRT2653931	hsa-miR-4505	CLIP-seq
MIRT1464898	hsa-miR-629	CLIP-seq
MIRT1464899	hsa-miR-654-3p	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
HSF2	Unknown	9374530
JUN	Unknown	12414792
PPARD	Activation	18048767

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0004791	Function	Thioredoxin-disulfide reductase (NADPH) activity	TAS
GO:0005515	Function	Protein binding	IPI	9108029, 10814541, 11118054, 15246877, 15480426, 15657067, 17260951, 17557078, 17606900, 19690162, 19805025, 20029029, 21145461, 21771788, 21988832, 24658140, 24976139, 25402766, 28514442, 31980649, 32296183, 32814053
GO:0005576	Component	Extracellular region	IDA	1332947
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IDA	9108029
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	9108029
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0009314	Process	Response to radiation	IDA	9108029, 11118054
GO:0015035	Function	Protein-disulfide reductase activity	IDA	2176490, 17182577, 19032234
GO:0015035	Function	Protein-disulfide reductase activity	IEA
GO:0019725	Process	Cellular homeostasis	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	9369469, 17260951
GO:0043388	Process	Positive regulation of DNA binding	IDA	11118054
GO:0045454	Process	Cell redox homeostasis	IDA	2176490
GO:0045454	Process	Cell redox homeostasis	IEA
GO:0045454	Process	Cell redox homeostasis	IMP	9108029
GO:0046826	Process	Negative regulation of protein export from nucleus	IEA
GO:0047134	Function	Protein-disulfide reductase [NAD(P)H] activity	IDA	17182577
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	22492997
GO:0061692	Process	Cellular detoxification of hydrogen peroxide	IGI	22492997
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0071731	Process	Response to nitric oxide	IMP	16408020, 17606900

MIM	HGNC	e!Ensembl
187700	12435	ENSG00000136810

P10599

Protein name

Thioredoxin (Trx) (ATL-derived factor) (ADF) (Surface-associated sulphydryl protein) (SASP) (allergen Hom s Trx)

Protein function

Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions (PubMed:17182577, PubMed:19032234, PubMed:2176490). Plays a role in the rever

PDB

1AIU , 1AUC , 1CQG , 1CQH , 1ERT , 1ERU , 1ERV , 1ERW , 1M7T , 1MDI , 1MDJ , 1MDK , 1TRS , 1TRU , 1TRV , 1TRW , 2HSH , 2HXK , 2IFQ , 2IIY , 3E3E , 3KD0 , 3M9J , 3M9K , 3QFA , 3QFB , 3TRX , 4LL1 , 4LL4 , 4OO4 , 4OO5 , 4POK , 4POL , 4POM , 4PUF , 4TRX , 5DQY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00085	Thioredoxin	2 → 103	Thioredoxin	Domain

Sequence

MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVD
DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Sequence length

105

Interactions

View interactions

	KEGG		Reactome
	NOD-like receptor signaling pathway Parkinson disease Salmonella infection Fluid shear stress and atherosclerosis		Oxidative Stress Induced Senescence Detoxification of Reactive Oxygen Species Interconversion of nucleotide di- and triphosphates TP53 Regulates Metabolic Genes Protein repair The NLRP3 inflammasome Purinergic signaling in leishmaniasis infection

TXN (thioredoxin)