Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	729230
Gene name	C-C motif chemokine receptor 2
Gene symbol	CCR2
Synonyms (NCBI Gene)	CC-CKR-2CCR-2CCR2ACCR2BCD192CKR2CKR2ACKR2BCMKBR2MCP-1-RPCLUD
Chromosome	3
Chromosome location	3p21.31
Summary	The protein encoded by this gene is a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rh

Show/Hide all (41)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018230	hsa-miR-335-5p	Microarray	18185580
MIRT037379	hsa-miR-744-3p	CLASH	23622248
MIRT527319	hsa-miR-618	PAR-CLIP	22012620
MIRT527318	hsa-miR-532-5p	PAR-CLIP	22012620
MIRT527316	hsa-miR-4539	PAR-CLIP	22012620
MIRT527317	hsa-miR-4680-5p	PAR-CLIP	22012620
MIRT527315	hsa-miR-214-5p	PAR-CLIP	22012620
MIRT527313	hsa-miR-6811-3p	PAR-CLIP	22012620
MIRT527314	hsa-miR-4633-5p	PAR-CLIP	22012620
MIRT527312	hsa-miR-6514-3p	PAR-CLIP	22012620
MIRT527319	hsa-miR-618	PAR-CLIP	22012620
MIRT527318	hsa-miR-532-5p	PAR-CLIP	22012620
MIRT527316	hsa-miR-4539	PAR-CLIP	22012620
MIRT527317	hsa-miR-4680-5p	PAR-CLIP	22012620
MIRT527315	hsa-miR-214-5p	PAR-CLIP	22012620
MIRT527313	hsa-miR-6811-3p	PAR-CLIP	22012620
MIRT527314	hsa-miR-4633-5p	PAR-CLIP	22012620
MIRT527312	hsa-miR-6514-3p	PAR-CLIP	22012620
MIRT756300	hsa-miR-125a-5p	Luciferase reporter assayImmunofluorescence	35401562
MIRT873202	hsa-miR-1179	CLIP-seq
MIRT873203	hsa-miR-144	CLIP-seq
MIRT873204	hsa-miR-2053	CLIP-seq
MIRT873205	hsa-miR-4699-3p	CLIP-seq
MIRT873206	hsa-miR-548ac	CLIP-seq
MIRT873207	hsa-miR-548ae	CLIP-seq
MIRT873208	hsa-miR-548aj	CLIP-seq
MIRT873209	hsa-miR-548am	CLIP-seq
MIRT873210	hsa-miR-548d-3p	CLIP-seq
MIRT873211	hsa-miR-548x	CLIP-seq
MIRT873212	hsa-miR-548z	CLIP-seq
MIRT1959078	hsa-miR-1236	CLIP-seq
MIRT1959079	hsa-miR-412	CLIP-seq
MIRT1959080	hsa-miR-4753-3p	CLIP-seq
MIRT1959081	hsa-miR-4778-3p	CLIP-seq
MIRT2196022	hsa-miR-1273e	CLIP-seq
MIRT2196023	hsa-miR-383	CLIP-seq
MIRT2196024	hsa-miR-4327	CLIP-seq
MIRT2196025	hsa-miR-4711-5p	CLIP-seq
MIRT2196026	hsa-miR-578	CLIP-seq
MIRT2196027	hsa-miR-1207-3p	CLIP-seq
MIRT2196028	hsa-miR-4267	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
NFKB1	Activation	19156404
RELA	Activation	19156404

130

Show/Hide all (130)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001650	Component	Fibrillar center	IDA
GO:0001974	Process	Blood vessel remodeling	IEA
GO:0001974	Process	Blood vessel remodeling	ISS
GO:0002407	Process	Dendritic cell chemotaxis	TAS	16621978
GO:0002548	Process	Monocyte chemotaxis	IEA
GO:0002724	Process	Regulation of T cell cytokine production	IEA
GO:0002724	Process	Regulation of T cell cytokine production	ISS
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	IEA
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	ISS
GO:0002829	Process	Negative regulation of type 2 immune response	IEA
GO:0002829	Process	Negative regulation of type 2 immune response	ISS
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	TAS	10623817
GO:0005515	Function	Protein binding	IPI	23938203, 25283965, 28514442, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	15995708
GO:0005886	Component	Plasma membrane	IDA	15995708, 18587271
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8146186, 10741397
GO:0006874	Process	Intracellular calcium ion homeostasis	ISS
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	10623817
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	TAS	10623817
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	10751368
GO:0006959	Process	Humoral immune response	IEA
GO:0006968	Process	Cellular defense response	IEA
GO:0006968	Process	Cellular defense response	TAS	10201901
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007194	Process	Negative regulation of adenylate cyclase activity	TAS	8995400
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	9548499
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	TAS	9670957
GO:0009611	Process	Response to wounding	TAS	8146186
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0010574	Process	Regulation of vascular endothelial growth factor production	IEA
GO:0010574	Process	Regulation of vascular endothelial growth factor production	ISS
GO:0010820	Process	Positive regulation of T cell chemotaxis	IEA
GO:0010820	Process	Positive regulation of T cell chemotaxis	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8530354
GO:0016493	Function	C-C chemokine receptor activity	IBA
GO:0016493	Function	C-C chemokine receptor activity	IDA	35570218
GO:0016493	Function	C-C chemokine receptor activity	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0016525	Process	Negative regulation of angiogenesis	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	15995708
GO:0019233	Process	Sensory perception of pain	IEA
GO:0019233	Process	Sensory perception of pain	ISS
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0019725	Process	Cellular homeostasis	IEA
GO:0019725	Process	Cellular homeostasis	ISS
GO:0019955	Function	Cytokine binding	IEA
GO:0019957	Function	C-C chemokine binding	IBA
GO:0030097	Process	Hemopoiesis	IEA
GO:0030425	Component	Dendrite	ISS
GO:0031727	Function	CCR2 chemokine receptor binding	IDA	15995708
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	ISS
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0032743	Process	Positive regulation of interleukin-2 production	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0035696	Process	Monocyte extravasation	IEA
GO:0035696	Process	Monocyte extravasation	ISS
GO:0035705	Process	T-helper 17 cell chemotaxis	IEA
GO:0035705	Process	T-helper 17 cell chemotaxis	ISS
GO:0035715	Function	Chemokine (C-C motif) ligand 2 binding	IEA
GO:0035716	Function	Chemokine (C-C motif) ligand 12 binding	IEA
GO:0035717	Function	Chemokine (C-C motif) ligand 7 binding	IEA
GO:0042802	Function	Identical protein binding	ISS
GO:0043025	Component	Neuronal cell body	ISS
GO:0043204	Component	Perikaryon	ISS
GO:0043310	Process	Negative regulation of eosinophil degranulation	IEA
GO:0043310	Process	Negative regulation of eosinophil degranulation	ISS
GO:0045580	Process	Regulation of T cell differentiation	IEA
GO:0045580	Process	Regulation of T cell differentiation	ISS
GO:0046641	Process	Positive regulation of alpha-beta T cell proliferation	IEA
GO:0046641	Process	Positive regulation of alpha-beta T cell proliferation	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050727	Process	Regulation of inflammatory response	ISS
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	ISS
GO:0050870	Process	Positive regulation of T cell activation	IEA
GO:0050870	Process	Positive regulation of T cell activation	ISS
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	IEA
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	ISS
GO:0060326	Process	Cell chemotaxis	IBA
GO:0061756	Process	Leukocyte adhesion to vascular endothelial cell	IEA
GO:0070098	Process	Chemokine-mediated signaling pathway	IDA	35570218
GO:0070098	Process	Chemokine-mediated signaling pathway	IDA	9182688
GO:0070098	Process	Chemokine-mediated signaling pathway	ISS
GO:0071345	Process	Cellular response to cytokine stimulus	IEA
GO:0071675	Process	Regulation of mononuclear cell migration	IEA
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IDA	18587271
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IEA
GO:0090026	Process	Positive regulation of monocyte chemotaxis	ISS
GO:0090265	Process	Positive regulation of immune complex clearance by monocytes and macrophages	IEA
GO:0090265	Process	Positive regulation of immune complex clearance by monocytes and macrophages	ISS
GO:0090594	Process	Inflammatory response to wounding	IEA
GO:0090594	Process	Inflammatory response to wounding	ISS
GO:0097350	Process	Neutrophil clearance	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	24906148
GO:1900451	Process	Positive regulation of glutamate receptor signaling pathway	ISS
GO:1903238	Process	Positive regulation of leukocyte tethering or rolling	IEA
GO:1905517	Process	Macrophage migration	IEA
GO:1905517	Process	Macrophage migration	ISS
GO:1905521	Process	Regulation of macrophage migration	IEA
GO:2000404	Process	Regulation of T cell migration	IEA
GO:2000412	Process	Positive regulation of thymocyte migration	IEA
GO:2000412	Process	Positive regulation of thymocyte migration	ISS
GO:2000439	Process	Positive regulation of monocyte extravasation	IEA
GO:2000439	Process	Positive regulation of monocyte extravasation	ISS
GO:2000451	Process	Positive regulation of CD8-positive, alpha-beta T cell extravasation	IEA
GO:2000451	Process	Positive regulation of CD8-positive, alpha-beta T cell extravasation	ISS
GO:2000464	Process	Positive regulation of astrocyte chemotaxis	IDA	12271471
GO:2000473	Process	Positive regulation of hematopoietic stem cell migration	IEA
GO:2000473	Process	Positive regulation of hematopoietic stem cell migration	ISS

MIM	HGNC	e!Ensembl
601267	1603	ENSG00000121807

P41597

Protein name

C-C chemokine receptor type 2 (C-C CKR-2) (CC-CKR-2) (CCR-2) (CCR2) (Monocyte chemoattractant protein 1 receptor) (MCP-1-R) (CD antigen CD192)

Protein function

Key functional receptor for CCL2 but can also bind CCL7, and CCL12 (PubMed:23408426, PubMed:38157855, PubMed:8048929, PubMed:8146186). Also transduces signaling mediated by CCL13 (PubMed:38157855). Its binding with CCL2 on monocytes and macropha

PDB

2MLO , 2MLQ , 5T1A , 7P8X , 7XA3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	59 → 305	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed by monocytes and IL2-activated NK cells (PubMed:9058802). Abundantly expressed on CD14+/CD16- monocytes and weakly on CD14+/CD16+ monocytes, type 2 dendritic cells (DCs) and plasmacytoid DCs (at protein level) (PubMed:3815785

Sequence

MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGN
MLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLY
HIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTK
CQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHR
AVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCI
NPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSI
GRAPEASLQDKEGA

Sequence length

374

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway		Beta defensins Chemokine receptors bind chemokines G alpha (i) signalling events Interleukin-10 signaling

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Cystic disease of lung	Pathogenic	rs2529520604, rs752561542, rs2529521725, rs1268159081, rs113340633	RCV003984972 RCV003984973 RCV003984974 RCV003984975 RCV003984976

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
CCR2-related disorder	Benign; protective; Likely benign	rs1799864, rs3092960, rs760736040, rs373111136, rs3918387, rs1799865	RCV003982833 RCV003984732 RCV003939372 RCV003969360 RCV003922135 RCV003981977
Susceptibility to HIV infection	Benign; protective; Uncertain significance	rs1799864, rs779248623, rs368150580	RCV000008756 RCV003224395 RCV003224394

Show/Hide Text Mining Associations (215)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acne Vulgaris	Associate	31281837
Acquired Immunodeficiency Syndrome	Associate	10486323, 11752157, 17786209, 18391751, 20531015, 20537184, 23880174, 24098976
Acquired Immunodeficiency Syndrome	Inhibit	21739027
Acute Coronary Syndrome	Associate	35563407
Adenocarcinoma	Associate	32509861
Adenocarcinoma of Lung	Associate	32337264, 32873769, 33949150, 34187403, 34863300, 35029906, 38111060
Adjustment Disorders	Associate	37500699
Aggressive Periodontitis	Associate	21264360
Alzheimer Disease	Associate	22607625, 29352259
Alzheimer Disease	Inhibit	23380586
Amyotrophic Lateral Sclerosis	Inhibit	22685564
Anemia Diamond Blackfan	Associate	29745857
Anxiety	Associate	28969474
Aortic Aneurysm Abdominal	Associate	16308497
Arthritis	Associate	18576354, 20133607, 28619088, 29880013
Arthritis Rheumatoid	Associate	11352233, 11762935, 18576354, 27411480, 31554310, 31729947, 33508012
Arthritis Rheumatoid	Stimulate	36194479
Ascites	Inhibit	10623817
Asthma	Associate	19520154, 20220260, 23454776, 23804543
Atherosclerosis	Associate	17499741, 17587761, 18164016
Atrial Fibrillation	Associate	32383373, 33834070, 35790963
Autoimmune Diseases	Associate	33386704, 35725391
Behcet Syndrome	Associate	26890122
Bone Diseases	Associate	21097672
Brain Diseases	Associate	34375978
Brain Neoplasms	Associate	35443752
Breast Neoplasms	Associate	20605053, 28420351, 34775491
Bronchiolitis Obliterans Syndrome	Associate	27982503
Burkitt Lymphoma	Stimulate	29751565
Burkitt Lymphoma	Associate	35408790
Calcinosis	Associate	22041342
Cap Myopathy	Associate	24970800
Carcinogenesis	Associate	26648448
Carcinoma Hepatocellular	Associate	29115520, 36938723, 39756577
Carcinoma Non Small Cell Lung	Associate	23090289, 25318604, 28424406, 35422093
Carcinoma Ovarian Epithelial	Associate	23551967
Carcinoma Renal Cell	Associate	23657965, 24327013, 27409666
Carcinoma Squamous Cell	Associate	22718118, 33717076, 37856813
Cardiomyopathy Dilated	Associate	37796701
Cardiovascular Diseases	Associate	36012132
Carotid Artery Diseases	Associate	19506371, 34140767
Carotid Stenosis	Associate	16308497, 18060801
Cerebral Infarction	Stimulate	22769019
Cerebral Infarction	Associate	22769019
Cholangiocarcinoma	Associate	33045415
Ciliary Motility Disorders	Associate	29116124
Cognition Disorders	Associate	26531691, 29352259, 35026420, 36601110
Cognitive Dysfunction	Associate	29352259
Colitis Collagenous	Stimulate	25948880
Colitis Lymphocytic	Stimulate	25948880
Colitis Ulcerative	Associate	34717557
Colorectal Neoplasms	Associate	29020986, 29154245, 33175885
Coronary Artery Disease	Associate	12742282, 36077273
Coronary Disease	Associate	27013693
COVID 19	Associate	33307546, 33413449, 34153417, 34183789, 34322810, 34543980, 34823125, 35131543, 36433939
Crohn Disease	Associate	15306587
Cystic Fibrosis	Associate	19000946
Death	Associate	21091093
Dermatitis Atopic 3	Associate	23454776
Diabetes Mellitus	Associate	28454543, 29992758, 36077273
Diabetes Mellitus Type 1	Inhibit	22787171
Diabetes Mellitus Type 1	Associate	28761107
Diabetes Mellitus Type 2	Associate	17428349, 32806763
Diabetic Nephropathies	Associate	17728497, 36969169
Down Syndrome	Associate	25222269
Drug Hypersensitivity	Associate	37876509
Drug Related Side Effects and Adverse Reactions	Associate	27965453
Dry Eye Syndromes	Stimulate	29673232
Dry Eye Syndromes	Associate	37876509
Emphysema	Associate	30532529
Encephalitis Japanese	Associate	29057937
Endometrial Hyperplasia	Associate	28951454
Endometrial Neoplasms	Associate	34251980
Endotoxemia	Inhibit	16426015
Eosinophilic enteropathy	Associate	35090021
Epidermolysis Bullosa	Associate	28736230
Epstein Barr Virus Infections	Stimulate	28892735, 29751565
Fibrosis	Associate	31100122
Fibrosis	Stimulate	31745210
Fibrous Dysplasia Polyostotic	Associate	18513341
Geographic Atrophy	Associate	32324857
Glioblastoma	Associate	35464424
Glomerulonephritis	Associate	18055544
Glomerulonephritis IGA	Associate	27788494, 37862725
Glomerulonephritis IGA	Stimulate	37908345
Graft vs Host Disease	Stimulate	15812393
Graves Disease	Associate	29319128
Graves Disease	Stimulate	37730733
Hashimoto Disease	Associate	36266640
Heart Failure	Associate	37796701
Hereditary Breast and Ovarian Cancer Syndrome	Associate	32393308
Herpes Zoster	Associate	34322810
HIV Infections	Associate	10486323, 16436595, 18845960, 20220260, 20411675, 20416280, 20537184, 20552027, 21429204, 23325742, 23880174, 24098976, 25313609, 26068906, 26300579 View all (7 more)
HIV Infections	Inhibit	21667221
HIV Infections	Stimulate	37480005
Hypercholesterolemia	Associate	10357837
Hyperlipoproteinemia Type II	Stimulate	10357837
Hyperplasia	Associate	32006659
Hypertension	Associate	22769019
Hypertrophy	Associate	34876548
Hypoxia	Stimulate	25411969, 32033172
Hypoxia	Associate	30402462
Idiopathic Pulmonary Fibrosis	Associate	33755690
Immune System Diseases	Associate	28951454
Infections	Associate	26300579, 26982176, 40353220
Inflammation	Associate	16037391, 16179368, 16297158, 18178718, 19620293, 20017911, 20220260, 22607625, 23657965, 24442440, 24497828, 25222269, 26430882, 27013693, 27481183 View all (17 more)
Inflammation	Stimulate	30759186, 37796701
Inflammatory Bowel Diseases	Associate	15306587, 29743615
Influenza Human	Associate	16297158
Insulin Resistance	Associate	26839895, 33508012
Intracranial Hypertension	Associate	17417600
Keratoconus	Associate	37001853
Kidney Diseases	Associate	18055544, 22041342, 36372857, 37862725, 38174742
Kidney Diseases	Stimulate	37908345
Kidney Failure Chronic	Inhibit	18235145
Kidney Failure Chronic	Associate	22041342
Latent Tuberculosis	Associate	33328540
Lentigo	Associate	27314341
Leprosy	Stimulate	19618084
Leukemia Large Granular Lymphocytic	Associate	18086899
Leukemia Monocytic Acute	Associate	29683844
Leukemia Myeloid Acute	Associate	27258612
Leukemia Myelomonocytic Acute	Associate	12829025
Liver Cirrhosis	Associate	20548789, 30239650
Liver Diseases	Associate	20548789
Liver Diseases Alcoholic	Associate	22861370
Lung Diseases	Associate	19620293
Lung Injury	Associate	35686910
Lung Neoplasms	Associate	19309748, 35422093
Lupus Erythematosus Cutaneous	Associate	30984198
Lupus Erythematosus Discoid	Associate	30984198
Lupus Erythematosus Systemic	Associate	14673999, 23298254, 28954264
Lupus Nephritis	Associate	38441377
Lymphatic Metastasis	Stimulate	26992207
Lymphoma	Associate	31919622
Lymphoma Follicular	Associate	11736935
Lymphoma Large B Cell Diffuse	Associate	35851856
Lymphoma Non Hodgkin	Associate	20038229
Macular Degeneration	Associate	23185481, 25503251
Measles	Associate	17538120
Medulloblastoma	Associate	31547819
Melanoma Cutaneous Malignant	Associate	31983065
Metabolic Syndrome	Associate	27013693
Migraine Disorders	Associate	19559392
Migraine with Aura	Associate	19559392
Mouth Neoplasms	Associate	36849997
Mucocutaneous Lymph Node Syndrome	Associate	16297158, 17672867
Multiple Myeloma	Associate	12644822, 12823344, 21097672
Multiple Sclerosis	Associate	30759186
Muscular Dystrophy Duchenne	Associate	28736230
Myocardial Infarction	Associate	32594092
Myotonic Dystrophy	Stimulate	24388654
Myxoma	Associate	12520153
Neoplasm Metastasis	Associate	24327013, 28424406, 29751565, 30203045, 33514011, 35851856, 36581051
Neoplasm Metastasis	Stimulate	28420351
Neoplasms	Associate	17216598, 17433654, 17686053, 21091093, 23090289, 23657965, 24327013, 24442440, 24970800, 25318604, 25411415, 26416897, 26733178, 26992207, 28039457 View all (18 more)
Neoplasms Adipose Tissue	Associate	26839895
Nephritis	Stimulate	35725391
Nerve Degeneration	Associate	34876548
Neuroblastoma	Associate	36923280
Non alcoholic Fatty Liver Disease	Inhibit	27309850
Non alcoholic Fatty Liver Disease	Associate	29733805, 32594092, 35790963
Obesity	Associate	20017911, 27481183, 28454543
Obesity	Stimulate	23804543
Obesity Abdominal	Associate	33965903
Osteoarthritis	Associate	11352237, 30403025, 31554310, 34876548
Osteoarthritis	Stimulate	29128509
Osteoarthritis Knee	Associate	32006659
Osteoporosis	Associate	33061329
Ovarian Neoplasms	Associate	10623817, 19351767, 26211665, 33921111
Pain	Associate	29128509
Pancreatic Neoplasms	Associate	36497150
Papillomavirus Infections	Associate	26982176
Parkinson Disease	Stimulate	30294923
Parkinson Disease	Associate	35026420
Periodic fever familial autosomal dominant	Stimulate	37500699
Plaque Atherosclerotic	Associate	19506371
Pre Eclampsia	Associate	32566660
Primary Myelofibrosis	Associate	32923146
Prostatic Neoplasms	Associate	17216598, 23839224, 25266801, 28039457, 33514011, 36321189, 38087324
Prostatitis	Stimulate	36321189
Psoriasis	Associate	15370700, 28011143
Pulmonary Arterial Hypertension	Associate	33680092
Pulmonary Disease Chronic Obstructive	Associate	37200921
Rectal Neoplasms	Stimulate	36733385
Renal Insufficiency	Associate	17428349
Renal Insufficiency Chronic	Associate	17428349, 38174742
Respiratory Distress Syndrome	Associate	27496101
Rhinitis Allergic	Associate	17982926
Scleroderma Systemic	Associate	33680092, 35216350
Skin Abnormalities	Associate	15370700
Skin Diseases	Associate	28954264
Sleep Apnea Obstructive	Stimulate	25411969
Squamous Cell Carcinoma of Head and Neck	Associate	28533507
Status Asthmaticus	Associate	19520154
Still's Disease Adult Onset	Associate	37500699
Stomach Neoplasms	Associate	21091093, 25411415, 26992207
Stroke	Stimulate	22769019
Stroke	Associate	22769019
Thyroid Cancer Papillary	Associate	36266640
Trigeminal Neuralgia	Stimulate	34067581
Triple Negative Breast Neoplasms	Associate	33587979
Tuberculosis	Associate	33328540
Tuberculosis Lymph Node	Associate	36439164
Tuberculosis Meningeal	Stimulate	37480005
Tuberculosis Multidrug Resistant	Inhibit	33977111
Urinary Bladder Neoplasms	Associate	20449800
Uterine Cervical Dysplasia	Associate	26982176
Uterine Cervical Neoplasms	Associate	17094383, 20537184, 26982176
Uterine Cervicitis	Associate	26982176
Uveitis Posterior	Associate	17417600
Vasculitis	Associate	39186910
Venous Thromboembolism	Associate	19263529
Viremia	Inhibit	24185941
Virus Diseases	Associate	18086899

CCR2 (C-C motif chemokine receptor 2)