Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7292
Gene name Gene Name - the full gene name approved by the HGNC.	TNF superfamily member 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TNFSF4
Synonyms (NCBI Gene) Gene synonyms aliases	CD134L, CD252, GP34, OX-40L, OX4OL, TNLG2B, TXGP1
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q25.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene h

Show/Hide all(310)

miRTarBase ID	miRNA	Experiments	Reference
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT670334	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT670333	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT670332	hsa-miR-603	HITS-CLIP	23824327
MIRT670331	hsa-miR-3941	HITS-CLIP	23824327
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT670334	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT670333	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT670332	hsa-miR-603	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT670331	hsa-miR-3941	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT670334	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT670334	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT670334	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT670334	hsa-miR-329-3p	HITS-CLIP	27418678
MIRT670333	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT670333	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT670333	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT670333	hsa-miR-362-3p	HITS-CLIP	27418678
MIRT670331	hsa-miR-3941	HITS-CLIP	27418678
MIRT670331	hsa-miR-3941	HITS-CLIP	27418678
MIRT670331	hsa-miR-3941	HITS-CLIP	27418678
MIRT670331	hsa-miR-3941	HITS-CLIP	27418678
MIRT670332	hsa-miR-603	HITS-CLIP	27418678
MIRT670332	hsa-miR-603	HITS-CLIP	27418678
MIRT670332	hsa-miR-603	HITS-CLIP	27418678
MIRT670332	hsa-miR-603	HITS-CLIP	27418678
MIRT615655	hsa-miR-8485	HITS-CLIP	27418678
MIRT615655	hsa-miR-8485	HITS-CLIP	27418678
MIRT615655	hsa-miR-8485	HITS-CLIP	27418678
MIRT615655	hsa-miR-8485	HITS-CLIP	27418678
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT670334	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT670333	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT670332	hsa-miR-603	HITS-CLIP	23824327
MIRT670331	hsa-miR-3941	HITS-CLIP	23824327
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT670334	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT670333	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT670332	hsa-miR-603	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT670331	hsa-miR-3941	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT615655	hsa-miR-8485	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT610653	hsa-miR-4682	HITS-CLIP	23824327
MIRT610652	hsa-miR-3182	HITS-CLIP	23824327
MIRT610651	hsa-miR-4303	HITS-CLIP	23824327
MIRT610650	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT1443526	hsa-miR-10a	CLIP-seq
MIRT1443527	hsa-miR-10b	CLIP-seq
MIRT1443528	hsa-miR-1255a	CLIP-seq
MIRT1443529	hsa-miR-1255b	CLIP-seq
MIRT1443530	hsa-miR-125a-5p	CLIP-seq
MIRT1443531	hsa-miR-125b	CLIP-seq
MIRT1443532	hsa-miR-1273f	CLIP-seq
MIRT1443533	hsa-miR-141	CLIP-seq
MIRT1443534	hsa-miR-143	CLIP-seq
MIRT1443535	hsa-miR-145	CLIP-seq
MIRT1443536	hsa-miR-186	CLIP-seq
MIRT1443537	hsa-miR-1972	CLIP-seq
MIRT1443538	hsa-miR-198	CLIP-seq
MIRT1443539	hsa-miR-200a	CLIP-seq
MIRT1443540	hsa-miR-2278	CLIP-seq
MIRT1443541	hsa-miR-2682	CLIP-seq
MIRT1443542	hsa-miR-27a	CLIP-seq
MIRT1443543	hsa-miR-27b	CLIP-seq
MIRT1443544	hsa-miR-2964a-5p	CLIP-seq
MIRT1443545	hsa-miR-3120-5p	CLIP-seq
MIRT1443546	hsa-miR-3133	CLIP-seq
MIRT1443547	hsa-miR-3152-5p	CLIP-seq
MIRT1443548	hsa-miR-3177-5p	CLIP-seq
MIRT1443549	hsa-miR-329	CLIP-seq
MIRT1443550	hsa-miR-3605-5p	CLIP-seq
MIRT1443551	hsa-miR-3908	CLIP-seq
MIRT1443552	hsa-miR-4310	CLIP-seq
MIRT1443553	hsa-miR-4319	CLIP-seq
MIRT1443554	hsa-miR-4324	CLIP-seq
MIRT1443555	hsa-miR-4421	CLIP-seq
MIRT1443556	hsa-miR-4459	CLIP-seq
MIRT1443557	hsa-miR-449c	CLIP-seq
MIRT1443558	hsa-miR-4652-3p	CLIP-seq
MIRT1443559	hsa-miR-4690-5p	CLIP-seq
MIRT1443560	hsa-miR-4708-5p	CLIP-seq
MIRT1443561	hsa-miR-4722-5p	CLIP-seq
MIRT1443562	hsa-miR-4747-5p	CLIP-seq
MIRT1443563	hsa-miR-4770	CLIP-seq
MIRT1443564	hsa-miR-4774-3p	CLIP-seq
MIRT1443565	hsa-miR-513a-5p	CLIP-seq
MIRT1443566	hsa-miR-522	CLIP-seq
MIRT1443567	hsa-miR-634	CLIP-seq
MIRT1443568	hsa-miR-764	CLIP-seq
MIRT1443569	hsa-miR-940	CLIP-seq
MIRT2132730	hsa-miR-1252	CLIP-seq
MIRT2132731	hsa-miR-216b	CLIP-seq
MIRT2132732	hsa-miR-224	CLIP-seq
MIRT2132733	hsa-miR-339-5p	CLIP-seq
MIRT2132734	hsa-miR-3606	CLIP-seq
MIRT2132735	hsa-miR-3611	CLIP-seq
MIRT2132736	hsa-miR-4287	CLIP-seq
MIRT2132737	hsa-miR-4420	CLIP-seq
MIRT2132738	hsa-miR-4469	CLIP-seq
MIRT2132739	hsa-miR-4685-3p	CLIP-seq
MIRT2132740	hsa-miR-4713-5p	CLIP-seq
MIRT2132741	hsa-miR-4786-3p	CLIP-seq
MIRT2353818	hsa-miR-101	CLIP-seq
MIRT1443549	hsa-miR-329	CLIP-seq
MIRT2132734	hsa-miR-3606	CLIP-seq
MIRT2132741	hsa-miR-4786-3p	CLIP-seq
MIRT2353819	hsa-miR-586	CLIP-seq
MIRT2396138	hsa-miR-219-5p	CLIP-seq
MIRT2396139	hsa-miR-4782-3p	CLIP-seq
MIRT2396140	hsa-miR-483-3p	CLIP-seq
MIRT2396141	hsa-miR-578	CLIP-seq
MIRT2441449	hsa-miR-1270	CLIP-seq
MIRT2441450	hsa-miR-1299	CLIP-seq
MIRT2441451	hsa-miR-4290	CLIP-seq
MIRT2441452	hsa-miR-4683	CLIP-seq
MIRT2441453	hsa-miR-4687-5p	CLIP-seq
MIRT2441454	hsa-miR-4782-5p	CLIP-seq
MIRT2441455	hsa-miR-516b	CLIP-seq
MIRT2441456	hsa-miR-620	CLIP-seq
MIRT2462104	hsa-miR-103b	CLIP-seq
MIRT1443549	hsa-miR-329	CLIP-seq
MIRT2462105	hsa-miR-376c	CLIP-seq
MIRT2647893	hsa-miR-122	CLIP-seq
MIRT2132730	hsa-miR-1252	CLIP-seq
MIRT1443528	hsa-miR-1255a	CLIP-seq
MIRT1443529	hsa-miR-1255b	CLIP-seq
MIRT2441449	hsa-miR-1270	CLIP-seq
MIRT2647894	hsa-miR-1273g	CLIP-seq
MIRT2441450	hsa-miR-1299	CLIP-seq
MIRT2647895	hsa-miR-138	CLIP-seq
MIRT2647896	hsa-miR-147	CLIP-seq
MIRT2647897	hsa-miR-153	CLIP-seq
MIRT2647898	hsa-miR-188-5p	CLIP-seq
MIRT1443537	hsa-miR-1972	CLIP-seq
MIRT1443538	hsa-miR-198	CLIP-seq
MIRT1443540	hsa-miR-2278	CLIP-seq
MIRT2647899	hsa-miR-2467-3p	CLIP-seq
MIRT2647900	hsa-miR-2467-5p	CLIP-seq
MIRT1443541	hsa-miR-2682	CLIP-seq
MIRT1443545	hsa-miR-3120-5p	CLIP-seq
MIRT2647901	hsa-miR-3134	CLIP-seq
MIRT1443547	hsa-miR-3152-5p	CLIP-seq
MIRT2647902	hsa-miR-3160-3p	CLIP-seq
MIRT1443548	hsa-miR-3177-5p	CLIP-seq
MIRT2647903	hsa-miR-3188	CLIP-seq
MIRT2647904	hsa-miR-3202	CLIP-seq
MIRT1443549	hsa-miR-329	CLIP-seq
MIRT2132733	hsa-miR-339-5p	CLIP-seq
MIRT2647905	hsa-miR-3591-5p	CLIP-seq
MIRT1443550	hsa-miR-3605-5p	CLIP-seq
MIRT2132734	hsa-miR-3606	CLIP-seq
MIRT2647906	hsa-miR-3617	CLIP-seq
MIRT2647907	hsa-miR-3678-3p	CLIP-seq
MIRT1443551	hsa-miR-3908	CLIP-seq
MIRT2647908	hsa-miR-3911	CLIP-seq
MIRT2647909	hsa-miR-3915	CLIP-seq
MIRT2647910	hsa-miR-3928	CLIP-seq
MIRT2647911	hsa-miR-3975	CLIP-seq
MIRT2647912	hsa-miR-4280	CLIP-seq
MIRT2441451	hsa-miR-4290	CLIP-seq
MIRT1443552	hsa-miR-4310	CLIP-seq
MIRT2647913	hsa-miR-4316	CLIP-seq
MIRT1443555	hsa-miR-4421	CLIP-seq
MIRT2647914	hsa-miR-4426	CLIP-seq
MIRT1443556	hsa-miR-4459	CLIP-seq
MIRT2647915	hsa-miR-4476	CLIP-seq
MIRT1443557	hsa-miR-449c	CLIP-seq
MIRT2647916	hsa-miR-4533	CLIP-seq
MIRT2647917	hsa-miR-4534	CLIP-seq
MIRT2647918	hsa-miR-4633-3p	CLIP-seq
MIRT2647919	hsa-miR-4647	CLIP-seq
MIRT1443558	hsa-miR-4652-3p	CLIP-seq
MIRT2647920	hsa-miR-4662b	CLIP-seq
MIRT2441452	hsa-miR-4683	CLIP-seq
MIRT2441453	hsa-miR-4687-5p	CLIP-seq
MIRT1443559	hsa-miR-4690-5p	CLIP-seq
MIRT2647921	hsa-miR-4719	CLIP-seq
MIRT1443561	hsa-miR-4722-5p	CLIP-seq
MIRT1443562	hsa-miR-4747-5p	CLIP-seq
MIRT1443564	hsa-miR-4774-3p	CLIP-seq
MIRT2647922	hsa-miR-4777-5p	CLIP-seq
MIRT2441454	hsa-miR-4782-5p	CLIP-seq
MIRT2132741	hsa-miR-4786-3p	CLIP-seq
MIRT2647923	hsa-miR-4786-5p	CLIP-seq
MIRT2647924	hsa-miR-4789-3p	CLIP-seq
MIRT2647925	hsa-miR-4802-3p	CLIP-seq
MIRT2647926	hsa-miR-485-5p	CLIP-seq
MIRT2441455	hsa-miR-516b	CLIP-seq
MIRT2647927	hsa-miR-518d-5p	CLIP-seq
MIRT2647928	hsa-miR-519b-5p	CLIP-seq
MIRT2647929	hsa-miR-519c-5p	CLIP-seq
MIRT2647930	hsa-miR-520c-5p	CLIP-seq
MIRT2647931	hsa-miR-526a	CLIP-seq
MIRT2647932	hsa-miR-548q	CLIP-seq
MIRT2441456	hsa-miR-620	CLIP-seq
MIRT1443567	hsa-miR-634	CLIP-seq
MIRT2647933	hsa-miR-641	CLIP-seq
MIRT2647934	hsa-miR-644	CLIP-seq
MIRT1443568	hsa-miR-764	CLIP-seq
MIRT2647935	hsa-miR-769-5p	CLIP-seq
MIRT1443569	hsa-miR-940	CLIP-seq
MIRT1443538	hsa-miR-198	CLIP-seq
MIRT2647909	hsa-miR-3915	CLIP-seq
MIRT2647910	hsa-miR-3928	CLIP-seq
MIRT2647914	hsa-miR-4426	CLIP-seq
MIRT2647919	hsa-miR-4647	CLIP-seq
MIRT2647920	hsa-miR-4662b	CLIP-seq
MIRT2647921	hsa-miR-4719	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
HDAC11	Activation	21239696

Show/Hide all(56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0001819	Process	Positive regulation of cytokine production	IBA
GO:0002215	Process	Defense response to nematode	ISS
GO:0002526	Process	Acute inflammatory response	ISS
GO:0002639	Process	Positive regulation of immunoglobulin production	ISS
GO:0002726	Process	Positive regulation of T cell cytokine production	ISS
GO:0002819	Process	Regulation of adaptive immune response	ISS
GO:0002830	Process	Positive regulation of type 2 immune response	ISS
GO:0002891	Process	Positive regulation of immunoglobulin mediated immune response	ISS
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	TAS	7913952
GO:0005125	Function	Cytokine activity	IEA
GO:0005164	Function	Tumor necrosis factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	16905106
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	17166734
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	NAS	18397322
GO:0005886	Component	Plasma membrane	TAS	7913952
GO:0006954	Process	Inflammatory response	IBA
GO:0006955	Process	Immune response	IEA
GO:0007154	Process	Cell communication	IEA
GO:0007165	Process	Signal transduction	TAS	7913952
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	7913952
GO:0009615	Process	Response to virus	ISS
GO:0009986	Component	Cell surface	IDA	18397322
GO:0016020	Component	Membrane	IEA
GO:0023052	Process	Signaling	IEA
GO:0032689	Process	Negative regulation of type II interferon production	ISS
GO:0032700	Process	Negative regulation of interleukin-17 production	IDA	18501882
GO:0032722	Process	Positive regulation of chemokine production	ISS
GO:0032729	Process	Positive regulation of type II interferon production	IDA	18501882
GO:0032733	Process	Positive regulation of interleukin-10 production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	ISS
GO:0032736	Process	Positive regulation of interleukin-13 production	ISS
GO:0032753	Process	Positive regulation of interleukin-4 production	IDA	18501882
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	20844189
GO:0032813	Function	Tumor necrosis factor receptor superfamily binding	IBA
GO:0032813	Function	Tumor necrosis factor receptor superfamily binding	ISS
GO:0035709	Process	Memory T cell activation	ISS
GO:0035712	Process	T-helper 2 cell activation	ISS
GO:0035713	Process	Response to nitrogen dioxide	ISS
GO:0042102	Process	Positive regulation of T cell proliferation	IBA
GO:0043372	Process	Positive regulation of CD4-positive, alpha-beta T cell differentiation	ISS
GO:0043382	Process	Positive regulation of memory T cell differentiation	ISS
GO:0045590	Process	Negative regulation of regulatory T cell differentiation	ISS
GO:0045626	Process	Negative regulation of T-helper 1 cell differentiation	ISS
GO:0045630	Process	Positive regulation of T-helper 2 cell differentiation	ISS
GO:0046641	Process	Positive regulation of alpha-beta T cell proliferation	ISS
GO:0050727	Process	Regulation of inflammatory response	ISS
GO:0050729	Process	Positive regulation of inflammatory response	IDA	20844189
GO:0050871	Process	Positive regulation of B cell activation	ISS
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	20844189
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IDA	19029446
GO:1900281	Process	Positive regulation of CD4-positive, alpha-beta T cell costimulation	ISS
GO:2000572	Process	Positive regulation of interleukin-4-dependent isotype switching to IgE isotypes	ISS

MIM	HGNC	e!Ensembl
603594	11934	ENSG00000117586

Protein

UniProt ID

P23510

Protein name

Tumor necrosis factor ligand superfamily member 4 (Glycoprotein Gp34) (OX40 ligand) (OX40L) (TAX transcriptionally-activated glycoprotein 1) (CD antigen CD252)

Protein function

Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.

PDB

2HEV

Family and domains

Sequence

MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQ
SIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQ
KDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEF
CVL

Sequence length

183

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction		TNFs bind their physiological receptors

Show/Hide Unknown Diseases (11)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alopecia Areata	Alopecia areata	N/A	N/A	GWAS
Asthma	Asthma (childhood onset), Atopic asthma, Asthma, Asthma onset (childhood vs adult), Asthma (age of onset)	N/A	N/A	GWAS
Dermatitis	Atopic dermatitis	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Diabetic Retinopathy	Diabetic retinopathy	N/A	N/A	GWAS
Eczema	Eczema	N/A	N/A	GWAS
Glioblastoma	Glioblastoma	N/A	N/A	GWAS
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS
Narcolepsy	Narcolepsy	N/A	N/A	GWAS
Rheumatoid arthritis	Rheumatoid arthritis	N/A	N/A	GWAS
Systemic lupus erythematosus	systemic lupus erythematosus, Systemic lupus erythematosus	N/A	N/A	GenCC, GWAS

Show/Hide Text Mining Associations (93)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Coronary Syndrome	Associate	21445270
Alzheimer Disease	Associate	37742913
Arthritis Rheumatoid	Associate	24532676, 25359291, 37457686
Aspergillosis Allergic Bronchopulmonary	Associate	20714107
Asthma	Associate	20139223, 24851948, 33656624, 34103634
Ataxia Telangiectasia	Associate	18674748
Atherosclerosis	Associate	18674748, 21445270, 22870213, 24068192, 29921578, 30797237
Autoimmune Diseases	Associate	22870213, 28470010, 30797237, 30944836, 36389676
Behcet Syndrome	Associate	27872495
Breast Neoplasms	Associate	22870213, 29949525, 31292534, 34545132, 35844785, 37643511
Bronchiolitis Obliterans Syndrome	Associate	11698307
Calcinosis Cutis	Associate	31501955
Carcinoma Hepatocellular	Associate	37861541
Carcinoma Non Small Cell Lung	Associate	34518312
Carcinoma Pancreatic Ductal	Associate	35936015
Cardiovascular Diseases	Associate	31871930
Carotid Artery Diseases	Associate	22870213
Carotid Stenosis	Associate	21393601, 30797237
Cerebral Small Vessel Diseases	Associate	30797237
Colorectal Neoplasms	Associate	26872462
Coronary Aneurysm	Associate	31783796
Coronary Artery Disease	Associate	24699314, 31783796
COVID 19	Associate	36389676
Death Sudden	Associate	31783796
Dermatitis Atopic	Associate	24851948, 32176307
Diabetes Mellitus	Associate	28045060
Diabetes Mellitus Type 1	Associate	31467932
Disease	Stimulate	31292534
Eczema	Associate	33656624
Eosinophilia	Associate	20139223
Epileptic Syndromes	Stimulate	22891927
Fibrosis	Associate	19778912
Gastritis	Associate	33777009
Glaucoma Open Angle	Associate	8889553
Graves Ophthalmopathy	Associate	35896115
Hashimoto Disease	Associate	27556446
Heart Diseases	Associate	18674748
Hereditary Breast and Ovarian Cancer Syndrome	Associate	22870213
Hodgkin Disease	Associate	21239696
Hypersensitivity Immediate	Associate	32176307
Hypertriglyceridemia	Associate	23216302
Hypertriglyceridemic Waist	Associate	23216302
Hypomagnesemia 5 Renal with Ocular Involvement	Associate	23936824
Hypothyroidism	Associate	27556446
Hypoxia	Stimulate	20197421
Immune System Diseases	Associate	35769457
Immunologic Deficiency Syndromes	Associate	28713926
Infections	Associate	26348892
Inflammation	Associate	20139223, 24068192, 24851948, 25652333
Inflammatory Bowel Diseases	Associate	30689765
Intracranial Arteriosclerosis	Associate	19589242
Intracranial Thrombosis	Associate	30797237
Kidney Diseases	Associate	21719445, 23936824
Leukemia Lymphocytic Chronic B Cell	Associate	15536147
Leukemia Lymphoma Adult T Cell	Associate	28420813, 9108415
Leukemia Myeloid Acute	Associate	30500073, 36151238
Leukemia T Cell	Associate	14984494
Lupus Erythematosus Systemic	Associate	19092840, 19357697, 19778912, 20169177, 20848568, 21719445, 21792837, 21905002, 22870213, 23874208, 23936824, 24699314, 25652333, 25890262, 26070486, 30568041, 31871930, 36189300 View all (3 more)
Lupus Nephritis	Associate	23936824
Lymphoma T Cell Cutaneous	Associate	34830466
Melanoma	Associate	31501955
Multiple Myeloma	Associate	34282497
Multiple Sclerosis	Stimulate	31181776
Musculoskeletal Diseases	Associate	31871930
Myasthenia Gravis	Associate	35265719
Mycosis Fungoides	Associate	34830466
Myocardial Infarction	Associate	21445270, 29921578
Narcolepsy	Associate	32669953
Neoplasm Metastasis	Associate	31703602
Neoplasms	Associate	11346458, 18397322, 22870213, 26420858, 26872462, 29949525, 34518312, 34830466, 35769457, 36389676, 39201666
Neoplasms	Stimulate	37139184
Neuroblastoma	Associate	12771917
Ovarian Neoplasms	Associate	34518312
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	33648458
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	14984494
Prostatic Neoplasms	Associate	31703602
Pulmonary Disease Chronic Obstructive	Stimulate	25775429
Pulmonary Emphysema	Associate	25775429
Purpura Thrombocytopenic Idiopathic	Associate	30944836
Rhinitis Allergic	Associate	28713926
Sarcoma Kaposi	Associate	23897980
Scleritis	Associate	33287909
Scleroderma Systemic	Associate	19778912, 22870213
Severe Acute Respiratory Syndrome	Stimulate	37261339
Sezary Syndrome	Associate	34830466
Sjogren's Syndrome	Associate	29655283
Squamous Cell Carcinoma of Head and Neck	Associate	32548602
Stomach Neoplasms	Associate	35528617
Tertiary Lymphoid Structures	Associate	32814992
Thyroiditis Autoimmune	Associate	27556446
Triple Negative Breast Neoplasms	Associate	36161312, 37924153
Uveomeningoencephalitic Syndrome	Associate	27872495
Virus Diseases	Associate	11346458

TNFSF4 (TNF superfamily member 4)