Gene Gene information from NCBI Gene database.
Entrez ID 7292
Gene name TNF superfamily member 4
Gene symbol TNFSF4
Synonyms (NCBI Gene)
CD134LCD252GP34OX-40LOX4OLTNLG2BTXGP1
Chromosome 1
Chromosome location 1q25.1
Summary This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene h
miRNA miRNA information provided by mirtarbase database.
310
miRTarBase ID miRNA Experiments Reference
MIRT615655 hsa-miR-8485 HITS-CLIP 23824327
MIRT670334 hsa-miR-329-3p HITS-CLIP 23824327
MIRT670333 hsa-miR-362-3p HITS-CLIP 23824327
MIRT670332 hsa-miR-603 HITS-CLIP 23824327
MIRT670331 hsa-miR-3941 HITS-CLIP 23824327
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
HDAC11 Activation 21239696
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
56
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0001819 Process Positive regulation of cytokine production IBA
GO:0002215 Process Defense response to nematode ISS
GO:0002526 Process Acute inflammatory response ISS
GO:0002639 Process Positive regulation of immunoglobulin production ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603594 11934 ENSG00000117586
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P23510
Protein name Tumor necrosis factor ligand superfamily member 4 (Glycoprotein Gp34) (OX40 ligand) (OX40L) (TAX transcriptionally-activated glycoprotein 1) (CD antigen CD252)
Protein function Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
PDB 2HEV
Family and domains
Sequence
MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQ
SIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQ
KDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEF
CVL
Sequence length 183
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction   TNFs bind their physiological receptors