Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7287
Gene name Gene Name - the full gene name approved by the HGNC.
TUB like protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TULP1
Synonyms (NCBI Gene) Gene synonyms aliases
LCA15, RP14, TUBL1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the tubby-like gene family (TULPs). Members of this family have been identified in plants, vertebrates, and invertebrates. TULP proteins share a conserved C-terminal region of approximately 200 amino acid residues. The protei
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs113772629 C>A,T Conflicting-interpretations-of-pathogenicity Coding sequence variant, synonymous variant, missense variant
rs121909073 C>G,T Uncertain-significance, pathogenic, not-provided Missense variant, coding sequence variant
rs121909074 A>G Pathogenic Missense variant, coding sequence variant
rs121909075 A>G,T Conflicting-interpretations-of-pathogenicity, pathogenic Missense variant, coding sequence variant
rs121909076 A>G Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT464981 hsa-miR-3118 PAR-CLIP 20371350
MIRT464980 hsa-miR-134-5p PAR-CLIP 20371350
MIRT464978 hsa-miR-4779 PAR-CLIP 20371350
MIRT464979 hsa-miR-6777-5p PAR-CLIP 20371350
MIRT464977 hsa-miR-6889-5p PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001750 Component Photoreceptor outer segment IEA
GO:0001750 Component Photoreceptor outer segment ISS
GO:0001895 Process Retina homeostasis IMP 15557452
GO:0001917 Component Photoreceptor inner segment IEA
GO:0001917 Component Photoreceptor inner segment ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602280 12423 ENSG00000112041
Protein
UniProt ID O00294
Protein name Tubby-related protein 1 (Tubby-like protein 1)
Protein function Required for normal development of photoreceptor synapses. Required for normal photoreceptor function and for long-term survival of photoreceptor cells. Interacts with cytoskeleton proteins and may play a role in protein transport in photorecept
PDB 2FIM , 3C5N
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01167 Tub 297 537 Tub family Domain
Tissue specificity TISSUE SPECIFICITY: Retina-specific.
Sequence
MPLRDETLREVWASDSGHEEESLSPEAPRRPKQRPAPAQRLRKKRTEAPESPCPTGSKPR
KPGAGRTGRPREEPSPDPAQARAPQTVYARFLRDPEAKKRDPRETFLVARAPDAEDEEEE
EEEDEEDEEEEAEEKKEKILLPPKKPLREKSSADLKERRAKAQGPRGDLGSPDPPPKPLR
VRNKEAPAGEGTKMRKTKKKGSGEADKDPSGSPASARKSPAAMFLVGEGSPDKKALKKKG
TPKGARKEEEEEEEAATVIKKSNQKGKAKGKGKKKAKEERAPSPPVEVDEPREFVLRPAP
QGRTVRCRLTRDKKGMDRGMYPSYFLHLDTEKKVFLLAGRKRKRSKTANYLISIDPTNLS
RGGENFIGKLRSNLLGNRFTVFDNGQNPQRGYSTNVASLRQELAAVIYETNVLGFRGPRR
MTVIIPGMSAENERVPIRPRNASDGLLVRWQNKTLESLIELHNKPPVWNDDSGSYTLNFQ
GRVTQASVKNFQIVHADDPDYIVLQFGRVAEDAFTLDYRYPLCALQAFAIALSSFDG
KLA
CE
Sequence length 542
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Leber Congenital Amaurosis leber congenital amaurosis, leber congenital amaurosis 15, Leber congenital amaurosis 1 rs1581742633, rs748972748, rs767030473, rs387906835, rs1581743256, rs281865168, rs1331834680, rs1327062642, rs387906836, rs1581735836, rs773968778, rs121909075, rs387906837, rs751589956, rs1581736024
View all (9 more)
N/A
retinal dystrophy Retinal dystrophy rs1305999116, rs1581742970, rs1331834680, rs281865168, rs387906836, rs1581735836, rs751589956, rs281865171, rs1761021773, rs387906837, rs766181526, rs121909076, rs774204108, rs763272975, rs760829254
View all (1 more)
N/A
Retinitis Pigmentosa retinitis pigmentosa, retinitis pigmentosa 14, Autosomal recessive retinitis pigmentosa rs1554125521, rs281865168, rs121909073, rs748972748, rs1581744084, rs121909075, rs121909076, rs751589956, rs281865171, rs201070350, rs1581738478, rs1581734819, rs763272975, rs62636511, rs774204108
View all (2 more)
N/A
Stargardt Disease stargardt disease rs1761021773 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alcohol Related Disorders Associate 40141211
Breast Neoplasms Associate 40141211
Cone Dystrophy Associate 36769033, 37165311
Cone Rod Dystrophies Associate 30090012
Disease Associate 36769033
Hepatitis C Associate 22841784
Hypertensive Retinopathy Associate 26448634, 40141211
Leber Congenital Amaurosis Associate 15024725, 18432314, 18936139, 31087526
Myopia Associate 30090012
Nerve Degeneration Associate 40141211