Gene Gene information from NCBI Gene database.
Entrez ID 728489
Gene name DNL-type zinc finger
Gene symbol DNLZ
Synonyms (NCBI Gene)
C9orf151HEPHEP1TIMM15ZIM17bA413M3.2
Chromosome 9
Chromosome location 9q34.3
miRNA miRNA information provided by mirtarbase database.
128
miRTarBase ID miRNA Experiments Reference
MIRT048063 hsa-miR-197-3p CLASH 23622248
MIRT488259 hsa-miR-4524b-3p PAR-CLIP 20371350
MIRT488257 hsa-miR-6760-5p PAR-CLIP 20371350
MIRT488256 hsa-miR-3141 PAR-CLIP 20371350
MIRT488255 hsa-miR-6805-5p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IDA 33857516
GO:0005654 Component Nucleoplasm IDA
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IBA
GO:0005739 Component Mitochondrion IDA 33857516
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
620797 33879 ENSG00000213221
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5SXM8
Protein name DNL-type zinc finger protein (Hsp70-escort protein 1) (HEP1) (mtHsp70-escort protein)
Protein function May function as a co-chaperone towards HSPA9/mortalin which, by itself, is prone to self-aggregation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05180 zf-DNL 70 135 DNL zinc finger Domain
Sequence
MLRTALRGAPRLLSRVQPRAPCLRRLWGRGARPEVAGRRRAWAWGWRRSSSEQGPGPAAA
LGRVEAAHYQLVYTCKVCGTRSSKRISKLAYHQGVVIVTCPGCQNHHIIADNLGWFSDLN
GKRNIEEILTARGEQ
VHRVAGEGALELVLEAAGAPTSTAAPEAGEDEGPPSPGKTEPS
Sequence length 178
Interactions View interactions