NALF1 (NALCN channel auxiliary factor 1)

Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
728215
Gene name Gene Name - the full gene name approved by the HGNC.
NALCN channel auxiliary factor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NALF1
Synonyms (NCBI Gene) Gene synonyms aliases
FAM155A, NLF-1, NLF1
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q33.3
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all(4)
GO ID Ontology Definition Evidence Reference
GO:0005886 Component Plasma membrane IBA 21873635
GO:0015275 Function Stretch-activated, cation-selective, calcium channel activity IBA 21873635
GO:0016021 Component Integral component of membrane IEA
GO:0098703 Process Calcium ion import across plasma membrane IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
619899 33877 ENSG00000204442
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID B1AL88
Protein name NALCN channel auxiliary factor 1 (Transmembrane protein FAM155A)
Protein function Auxillary component of the NALCN sodium channel complex, a channel that regulates the resting membrane potential and controls neuronal excitability.
PDB 6XIW , 7CM3 , 7SX3 , 7SX4 , 7WJI
Family and domains
Sequence 
MTRGAWMCRQYDDGLKIWLAAPRENEKPFIDSERAQKWRLSLASLLFFTVLLSDHLWFCA
EAKLTRARDKEHQQQQRQQQQQQQQQRQRQQQQQQRRQQEPSWPALLASMGESSPAAQAH
RLLSASSSPTLPPSPGDGGGGGGKGNRGKDDRGKALFLGNSAKPVWRLETCYPQGASSGQ
CFTVENADAVCARNWSRGAAGGDGQEVRSKHPTPLWNLSDFYLSFCNSYTLWELFSGLSS
PNTLNCSLDVVLKEGGEMTTCRQCVEAYQDYDHHAQEKYEEFESVLHKYLQSEEYSVKSC
PEDCKIVYKAWLCSQYFEVTQFNCRKTIPCKQYCLEVQTRCPFILPDNDEVIYGGLSSFI
CTGLYETFLTNDEPECCDVRREEKSNNPSKGTVEKSGSCHRTSLTVSSATRLCNSRLKLC
VLVLILLHTVLTASAAQNTAGLSFGGINTLEENSTNEE
Sequence length 458
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Lung carcinoma Squamous cell carcinoma of lung rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355
View all (44 more)		 29924316
Non-obstructive azoospermia Non-obstructive azoospermia rs587777872, rs879253743, rs1600840291, rs1600877766, rs753462162, rs1588618614, rs1602684496, rs377712900 22197933
Show/Hide Unknown Diseases (11)
Unknown
Disease term Disease name Evidence References Source
Anorexia Anorexia GWAS
Lung adenocarcinoma Lung adenocarcinoma Validation that loss of Tgfbr2 results in more aggressive and T cell-excluded KP lung tumors GWAS, CBGDA
Gout Gout GWAS
Diverticulitis Diverticulitis GWAS