Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7270
Gene name Gene Name - the full gene name approved by the HGNC.	Transcription termination factor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TTF1
Synonyms (NCBI Gene) Gene synonyms aliases	TTF-1, TTF-I
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9q34.13
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a transcription termination factor that is localized to the nucleolus and plays a critical role in ribosomal gene transcription. The encoded protein mediates the termination of RNA polymerase I transcription by binding to Sal box termina

Show/Hide all(61)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020919	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT439140	hsa-let-7c-5p	3'LIFE	25074381
MIRT439140	hsa-let-7c-5p	3'LIFE	25074381
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT1462030	hsa-miR-197	CLIP-seq
MIRT1462031	hsa-miR-1972	CLIP-seq
MIRT1462032	hsa-miR-24	CLIP-seq
MIRT1462033	hsa-miR-3125	CLIP-seq
MIRT1462034	hsa-miR-3916	CLIP-seq
MIRT1462035	hsa-miR-412	CLIP-seq
MIRT1462036	hsa-miR-4284	CLIP-seq
MIRT1462037	hsa-miR-4650-5p	CLIP-seq
MIRT1462038	hsa-miR-4680-5p	CLIP-seq
MIRT1462039	hsa-miR-4716-5p	CLIP-seq
MIRT1462040	hsa-miR-4772-3p	CLIP-seq
MIRT1462041	hsa-miR-4781-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq
MIRT1462043	hsa-miR-520a-5p	CLIP-seq
MIRT1462044	hsa-miR-525-5p	CLIP-seq
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT1462045	hsa-miR-1976	CLIP-seq
MIRT1462046	hsa-miR-4279	CLIP-seq
MIRT1462047	hsa-miR-4722-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT1462045	hsa-miR-1976	CLIP-seq
MIRT1462046	hsa-miR-4279	CLIP-seq
MIRT1462047	hsa-miR-4722-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT1462032	hsa-miR-24	CLIP-seq
MIRT1462036	hsa-miR-4284	CLIP-seq
MIRT1462040	hsa-miR-4772-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT2462626	hsa-miR-150	CLIP-seq
MIRT1462045	hsa-miR-1976	CLIP-seq
MIRT1462046	hsa-miR-4279	CLIP-seq
MIRT1462047	hsa-miR-4722-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT2462626	hsa-miR-150	CLIP-seq
MIRT1462045	hsa-miR-1976	CLIP-seq
MIRT1462046	hsa-miR-4279	CLIP-seq
MIRT1462047	hsa-miR-4722-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq
MIRT2653015	hsa-miR-1244	CLIP-seq
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT2462626	hsa-miR-150	CLIP-seq
MIRT1462045	hsa-miR-1976	CLIP-seq
MIRT1462046	hsa-miR-4279	CLIP-seq
MIRT2653016	hsa-miR-4703-3p	CLIP-seq
MIRT1462047	hsa-miR-4722-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq
MIRT2653015	hsa-miR-1244	CLIP-seq
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT2462626	hsa-miR-150	CLIP-seq
MIRT1462045	hsa-miR-1976	CLIP-seq
MIRT1462046	hsa-miR-4279	CLIP-seq
MIRT1462047	hsa-miR-4722-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	28169274
GO:0005634	Component	Nucleus	NAS	7597036
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IBA	21873635
GO:0005730	Component	Nucleolus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0006353	Process	DNA-templated transcription, termination	NAS	7597036
GO:0006363	Process	Termination of RNA polymerase I transcription	IBA	21873635
GO:0006363	Process	Termination of RNA polymerase I transcription	TAS
GO:0008156	Process	Negative regulation of DNA replication	IEA
GO:0044267	Process	Cellular protein metabolic process	TAS

MIM	HGNC	e!Ensembl
600777	12397	ENSG00000125482

Protein

UniProt ID

Q15361

Protein name

Transcription termination factor 1 (TTF-1) (RNA polymerase I termination factor) (Transcription termination factor I) (TTF-I)

Protein function

Multifunctional nucleolar protein that terminates ribosomal gene transcription, mediates replication fork arrest and regulates RNA polymerase I transcription on chromatin. Plays a dual role in rDNA regulation, being involved in both activation a

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13921	Myb_DNA-bind_6	620 → 677		Domain

Sequence

MEGESSRFEIHTPVSDKKKKKCSIHKERPQKHSHEIFRDSSLVNEQSQITRRKKRKKDFQ
HLISSPLKKSRICDETANATSTLKKRKKRRYSALEVDEEAGVTVVLVDKENINNTPKHFR
KDVDVVCVDMSIEQKLPRKPKTDKFQVLAKSHAHKSEALHSKVREKKNKKHQRKAASWES
QRARDTLPQSESHQEESWLSVGPGGEITELPASAHKNKSKKKKKKSSNREYETLAMPEGS
QAGREAGTDMQESQPTVGLDDETPQLLGPTHKKKSKKKKKKKSNHQEFEALAMPEGSQVG
SEVGADMQESRPAVGLHGETAGIPAPAYKNKSKKKKKKSNHQEFEAVAMPESLESAYPEG
SQVGSEVGTVEGSTALKGFKESNSTKKKSKKRKLTSVKRARVSGDDFSVPSKNSESTLFD
SVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPANEEHNVETAEDSEIRYLSAD
SGDADDSDADLGSAVKQLQEFIPNIKDRATSTIKRMYRDDLERFKEFKAQGVAIKFGKFS
VKENKQLEKNVEDFLALTGIESADKLLYTDRYPEEKSVITNLKRRYSFRLHIGRNIARPW
KLIYYRAKKMFDVNNYKGRYSEGDTEKLKMYHSLLGNDWKTIGEMVARSSLSVALKFSQI
SSQRNRGAWSKSETRKLIKAVEEVILKKMSPQELKEVDSKLQENPESCLSIVREKLYKGI
SWVEVEAKVQTRNWMQCKSKWTEILTKRMTNGRRIYYGMNALRAKVSLIERLYEINVEDT
NEIDWEDLASAIGDVPPSYVQTKFSRLKAVYVPFWQKKTFPEIIDYLYETTLPLLKEKLE
KMMEKKGTKIQTPAAPKQVFPFRDIFYYEDDSEGEDIEKESEGQAPCMAHACNSSTLGGQ
GRWII

Sequence length

905

Interactions

View interactions

	KEGG		Reactome
	Thyroid hormone synthesis		Surfactant metabolism RNA Polymerase I Transcription Initiation RNA Polymerase I Transcription Termination

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Lung adenocarcinoma	Adenocarcinoma of lung (disorder)	rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370 View all (5 more)	25851810

Show/Hide Text Mining Associations (80)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	15188024, 18932182, 20173733, 23190601, 23196793, 25086987, 25733373, 25926247, 28060732, 29443782, 30092812, 31646818, 34019236, 34916369, 35093316, 37338116, 38124509, 38291083 View all (3 more)
Adenocarcinoma	Stimulate	26456962, 30379223
Adenocarcinoma	Inhibit	36845145
Adenocarcinoma Mucinous	Associate	28677170
Adenocarcinoma of Lung	Associate	15188024, 15861215, 16570563, 18320074, 22439932, 23358112, 23617826, 23887294, 24097870, 24594201, 24743427, 25060702, 25337222, 25733373, 26069186 View all (14 more)
Adenocarcinoma of Lung	Inhibit	22460811
Adenocarcinoma Papillary	Associate	36705380
Adenoma Pleomorphic	Associate	22847723
Adrenal Gland Diseases	Associate	23510370
Astrocytoma	Associate	24913303, 37088465
Brain Neoplasms	Associate	24913303, 31646818
Breast Neoplasms	Associate	27983521
Carcinogenesis	Associate	33980985
Carcinoid Tumor	Inhibit	25884169
Carcinoid Tumor	Associate	29770932
Carcinoma	Inhibit	19506552
Carcinoma	Associate	28731042, 30723294, 33761111
Carcinoma Acinar Cell	Associate	28677170
Carcinoma Endometrioid	Associate	18246044
Carcinoma Large Cell	Associate	16862075, 23196793, 28884744, 33031101
Carcinoma Merkel Cell	Associate	18587322, 36745184
Carcinoma Mucoepidermoid	Associate	26575266
Carcinoma Neuroendocrine	Associate	22847723, 23787483, 27187870
Carcinoma Non Small Cell Lung	Associate	18932182, 19279207, 22982653, 24244672, 25854394, 26456962, 30379223, 30914778, 30956278, 31556560, 31782890, 38291083, 39689601
Carcinoma Papillary	Associate	21060764, 28731042
Carcinoma Renal Cell	Associate	18246044, 27393506
Carcinoma Signet Ring Cell	Associate	23041828, 23573309
Carcinoma Small Cell	Associate	16862075, 23358112
Carcinoma Squamous Cell	Stimulate	18932182, 30379223
Carcinoma Squamous Cell	Associate	23196793, 24594201, 27028392, 31263838, 35093316, 37338116, 38291083
Carcinosarcoma	Associate	22847723
Choreoathetosis Hypothyroidism And Neonatal Respiratory Distress	Associate	18246044, 19887917, 24913303
Colonic Neoplasms	Associate	15861215
Colorectal Neoplasms	Associate	15861215
COVID 19	Associate	33173052
Disease	Associate	33761111
Endodermal Sinus Tumor	Associate	27443515
Endometrial Neoplasms	Associate	22460811
Enteritis	Associate	40560796
Farber Lipogranulomatosis	Associate	18932182
Gastritis	Associate	37962678
Glioblastoma	Associate	24913303
Glioma Subependymal	Associate	37088465
Goiter	Associate	7635972
Leigh syndrome French Canadian type	Associate	25337222
Lung Diseases	Associate	19238079, 25337222, 31142791
Lung Injury	Associate	33173052
Lung Neoplasms	Associate	17925434, 19279207, 22185756, 24594201, 26912193, 27983521, 30379223, 31142791, 31983097, 9059352
Lymphedema	Associate	7635972
Mesothelioma	Associate	23041828
Mesothelioma Malignant	Associate	26939861
Neoplasm Invasiveness	Associate	19238079
Neoplasm Metastasis	Associate	15861215, 33876327
Neoplasms	Inhibit	18932182, 22460811
Neoplasms	Associate	19887917, 21060764, 22400077, 23119115, 23358112, 23934203, 25884169, 27543867, 27983521, 28060732, 28349943, 28574510, 28697743, 29415898, 29770932 View all (15 more)
Neoplasms	Stimulate	28249616, 33813463, 37058118
Neoplasms Cystic Mucinous and Serous	Associate	18246044
Neoplastic Cells Circulating	Associate	36499466
Neurocytoma	Associate	37088465
Neuroectodermal Tumors	Associate	33876327
Neuroendocrine Tumors	Associate	27543867, 33011388
Oncocytoma renal	Associate	21590491, 37088465
Ovarian Diseases	Associate	27443515
Ovarian Neoplasms	Associate	18246044, 27443515
Paraganglioma	Associate	32668278
Persistent Mullerian duct syndrome	Associate	20808915
Pleural Effusion	Associate	25337222
Pulmonary Alveolar Proteinosis	Associate	24859540
Pulmonary Sclerosing Hemangioma	Associate	25130377
Respiratory Distress Syndrome	Associate	21784970
Small Cell Lung Carcinoma	Associate	23358112, 25889870, 28349943, 31161851, 31263838, 31782890, 33011388, 36745184, 39392394, 9059352
Superior Vena Cava Syndrome	Associate	31983097
Thyroid Cancer Papillary	Associate	36705380
Thyroid Carcinoma Anaplastic	Associate	34751390
Thyroid Dysgenesis	Associate	30022773
Thyroid Neoplasms	Associate	18958156, 23358112, 31238008, 33813463, 36499466, 9854590
Thyroid Neoplasms	Inhibit	19506552
Thyroiditis	Associate	19506552, 23510370, 29381957, 31238008
Triple Negative Breast Neoplasms	Associate	28697743
Urinary Bladder Neoplasms	Associate	19887917

TTF1 (transcription termination factor 1)