TTF1 (transcription termination factor 1)

Gene

• Entrez ID: 7270
• Gene name: Transcription termination factor 1
• Gene symbol: TTF1
• Synonyms (NCBI Gene): TTF-1, TTF-I
• Chromosome: 9
• Chromosome location: 9q34.13
• Summary: This gene encodes a transcription termination factor that is localized to the nucleolus and plays a critical role in ribosomal gene transcription. The encoded protein mediates the termination of RNA polymerase I transcription by binding to Sal box termina

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020919	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT439140	hsa-let-7c-5p	3'LIFE	25074381
MIRT439140	hsa-let-7c-5p	3'LIFE	25074381
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT1462030	hsa-miR-197	CLIP-seq
MIRT1462031	hsa-miR-1972	CLIP-seq
MIRT1462032	hsa-miR-24	CLIP-seq
MIRT1462033	hsa-miR-3125	CLIP-seq
MIRT1462034	hsa-miR-3916	CLIP-seq
MIRT1462035	hsa-miR-412	CLIP-seq
MIRT1462036	hsa-miR-4284	CLIP-seq
MIRT1462037	hsa-miR-4650-5p	CLIP-seq
MIRT1462038	hsa-miR-4680-5p	CLIP-seq
MIRT1462039	hsa-miR-4716-5p	CLIP-seq
MIRT1462040	hsa-miR-4772-3p	CLIP-seq
MIRT1462041	hsa-miR-4781-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq
MIRT1462043	hsa-miR-520a-5p	CLIP-seq
MIRT1462044	hsa-miR-525-5p	CLIP-seq
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT1462045	hsa-miR-1976	CLIP-seq
MIRT1462046	hsa-miR-4279	CLIP-seq
MIRT1462047	hsa-miR-4722-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT1462045	hsa-miR-1976	CLIP-seq
MIRT1462046	hsa-miR-4279	CLIP-seq
MIRT1462047	hsa-miR-4722-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT1462032	hsa-miR-24	CLIP-seq
MIRT1462036	hsa-miR-4284	CLIP-seq
MIRT1462040	hsa-miR-4772-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT2462626	hsa-miR-150	CLIP-seq
MIRT1462045	hsa-miR-1976	CLIP-seq
MIRT1462046	hsa-miR-4279	CLIP-seq
MIRT1462047	hsa-miR-4722-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT2462626	hsa-miR-150	CLIP-seq
MIRT1462045	hsa-miR-1976	CLIP-seq
MIRT1462046	hsa-miR-4279	CLIP-seq
MIRT1462047	hsa-miR-4722-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq
MIRT2653015	hsa-miR-1244	CLIP-seq
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT2462626	hsa-miR-150	CLIP-seq
MIRT1462045	hsa-miR-1976	CLIP-seq
MIRT1462046	hsa-miR-4279	CLIP-seq
MIRT2653016	hsa-miR-4703-3p	CLIP-seq
MIRT1462047	hsa-miR-4722-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq
MIRT2653015	hsa-miR-1244	CLIP-seq
MIRT1462029	hsa-miR-1343	CLIP-seq
MIRT2462626	hsa-miR-150	CLIP-seq
MIRT1462045	hsa-miR-1976	CLIP-seq
MIRT1462046	hsa-miR-4279	CLIP-seq
MIRT1462047	hsa-miR-4722-3p	CLIP-seq
MIRT1462042	hsa-miR-498	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001650	Component	Fibrillar center	IDA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IBA
GO:0003682	Function	Chromatin binding	IEA
GO:0005515	Function	Protein binding	IPI	28169274
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	7597036
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006353	Process	DNA-templated transcription termination	IEA
GO:0006353	Process	DNA-templated transcription termination	NAS	7597036
GO:0006360	Process	Transcription by RNA polymerase I	IEA
GO:0006361	Process	Transcription initiation at RNA polymerase I promoter	IEA
GO:0006363	Process	Termination of RNA polymerase I transcription	IBA
GO:0006363	Process	Termination of RNA polymerase I transcription	IEA
GO:0006363	Process	Termination of RNA polymerase I transcription	ISS
GO:0008156	Process	Negative regulation of DNA replication	IEA

Other IDs

• MIM: 600777
• HGNC: 12397
• e!Ensembl: ENSG00000125482

Protein

• UniProt ID: Q15361
• Protein name: Transcription termination factor 1 (TTF-1) (RNA polymerase I termination factor) (Transcription termination factor I) (TTF-I)
• Protein function: Multifunctional nucleolar protein that terminates ribosomal gene transcription, mediates replication fork arrest and regulates RNA polymerase I transcription on chromatin. Plays a dual role in rDNA regulation, being involved in both activation a
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13921	Myb_DNA-bind_6	620 → 677		Domain

• Sequence:

  MEGESSRFEIHTPVSDKKKKKCSIHKERPQKHSHEIFRDSSLVNEQSQITRRKKRKKDFQ
  HLISSPLKKSRICDETANATSTLKKRKKRRYSALEVDEEAGVTVVLVDKENINNTPKHFR
  KDVDVVCVDMSIEQKLPRKPKTDKFQVLAKSHAHKSEALHSKVREKKNKKHQRKAASWES
  QRARDTLPQSESHQEESWLSVGPGGEITELPASAHKNKSKKKKKKSSNREYETLAMPEGS
  QAGREAGTDMQESQPTVGLDDETPQLLGPTHKKKSKKKKKKKSNHQEFEALAMPEGSQVG
  SEVGADMQESRPAVGLHGETAGIPAPAYKNKSKKKKKKSNHQEFEAVAMPESLESAYPEG
  SQVGSEVGTVEGSTALKGFKESNSTKKKSKKRKLTSVKRARVSGDDFSVPSKNSESTLFD
  SVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPANEEHNVETAEDSEIRYLSAD
  SGDADDSDADLGSAVKQLQEFIPNIKDRATSTIKRMYRDDLERFKEFKAQGVAIKFGKFS
  VKENKQLEKNVEDFLALTGIESADKLLYTDRYPEEKSVITNLKRRYSFRLHIGRNIARPW
  KLIYYRAKKMFDVNNYKGRYSEGDTEKLKMYHSLLGNDWKTIGEMVARSSLSVALKFSQI
  SSQRNRGAWSKSETRKLIKAVEEVILKKMSPQELKEVDSKLQENPESCLSIVREKLYKGI
  SWVEVEAKVQTRNWMQCKSKWTEILTKRMTNGRRIYYGMNALRAKVSLIERLYEINVEDT
  NEIDWEDLASAIGDVPPSYVQTKFSRLKAVYVPFWQKKTFPEIIDYLYETTLPLLKEKLE
  KMMEKKGTKIQTPAAPKQVFPFRDIFYYEDDSEGEDIEKESEGQAPCMAHACNSSTLGGQ
  GRWII

• Sequence length: 905

Pathways

KEGG:

Thyroid hormone synthesis

Reactome:

Surfactant metabolism
RNA Polymerase I Transcription Initiation
RNA Polymerase I Transcription Termination

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Hypothyroidism, congenital, nongoitrous, 2	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma	Associate	15188024, 18932182, 20173733, 23190601, 23196793, 25086987, 25733373, 25926247, 28060732, 29443782, 30092812, 31646818, 34019236, 34916369, 35093316, 37338116, 38124509, 38291083	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Stimulate	26456962, 30379223	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Inhibit	36845145	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Mucinous	Associate	28677170	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	15188024, 15861215, 16570563, 18320074, 22439932, 23358112, 23617826, 23887294, 24097870, 24594201, 24743427, 25060702, 25337222, 25733373, 26069186, 26661061, 26725982, 26912193, 27028392, 27062706, 28474808, 28677170, 31142791, 31196060, 31782890, 33247694, 34014042, 36355617, 37338116	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Inhibit	22460811	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Papillary	Associate	36705380	★☆☆☆☆ Found in Text Mining only
Adenoma Pleomorphic	Associate	22847723	★☆☆☆☆ Found in Text Mining only
Adrenal Gland Diseases	Associate	23510370	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Associate	24913303, 37088465	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Associate	24913303, 31646818	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	27983521	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	33980985	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Inhibit	25884169	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Associate	29770932	★☆☆☆☆ Found in Text Mining only
Carcinoma	Inhibit	19506552	★☆☆☆☆ Found in Text Mining only
Carcinoma	Associate	28731042, 30723294, 33761111	★☆☆☆☆ Found in Text Mining only
Carcinoma Acinar Cell	Associate	28677170	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Associate	18246044	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Associate	16862075, 23196793, 28884744, 33031101	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Associate	18587322, 36745184	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Associate	26575266	★☆☆☆☆ Found in Text Mining only
Carcinoma Neuroendocrine	Associate	22847723, 23787483, 27187870	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	18932182, 19279207, 22982653, 24244672, 25854394, 26456962, 30379223, 30914778, 30956278, 31556560, 31782890, 38291083, 39689601	★☆☆☆☆ Found in Text Mining only
Carcinoma Papillary	Associate	21060764, 28731042	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	18246044, 27393506	★☆☆☆☆ Found in Text Mining only
Carcinoma Signet Ring Cell	Associate	23041828, 23573309	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Associate	16862075, 23358112	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Stimulate	18932182, 30379223	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	23196793, 24594201, 27028392, 31263838, 35093316, 37338116, 38291083	★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Associate	22847723	★☆☆☆☆ Found in Text Mining only
Choreoathetosis Hypothyroidism And Neonatal Respiratory Distress	Associate	18246044, 19887917, 24913303	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	15861215	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	15861215	★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	33173052	★☆☆☆☆ Found in Text Mining only
Disease	Associate	33761111	★☆☆☆☆ Found in Text Mining only
Endodermal Sinus Tumor	Associate	27443515	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Associate	22460811	★☆☆☆☆ Found in Text Mining only
Enteritis	Associate	40560796	★☆☆☆☆ Found in Text Mining only
Farber Lipogranulomatosis	Associate	18932182	★☆☆☆☆ Found in Text Mining only
Gastritis	Associate	37962678	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	24913303	★☆☆☆☆ Found in Text Mining only
Glioma Subependymal	Associate	37088465	★☆☆☆☆ Found in Text Mining only
Goiter	Associate	7635972	★☆☆☆☆ Found in Text Mining only
Leigh syndrome French Canadian type	Associate	25337222	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Associate	19238079, 25337222, 31142791	★☆☆☆☆ Found in Text Mining only
Lung Injury	Associate	33173052	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	17925434, 19279207, 22185756, 24594201, 26912193, 27983521, 30379223, 31142791, 31983097, 9059352	★☆☆☆☆ Found in Text Mining only
Lymphedema	Associate	7635972	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Associate	23041828	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Associate	26939861	★☆☆☆☆ Found in Text Mining only
Neoplasm Invasiveness	Associate	19238079	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	15861215, 33876327	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	18932182, 22460811	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	19887917, 21060764, 22400077, 23119115, 23358112, 23934203, 25884169, 27543867, 27983521, 28060732, 28349943, 28574510, 28697743, 29415898, 29770932, 30258080, 31238008, 31426797, 31699114, 32390944, 33393527, 34838061, 34997561, 35545361, 35663322, 36239545, 36499466, 37019411, 38041048, 40214375	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	28249616, 33813463, 37058118	★☆☆☆☆ Found in Text Mining only
Neoplasms Cystic Mucinous and Serous	Associate	18246044	★☆☆☆☆ Found in Text Mining only
Neoplastic Cells Circulating	Associate	36499466	★☆☆☆☆ Found in Text Mining only
Neurocytoma	Associate	37088465	★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors	Associate	33876327	★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Associate	27543867, 33011388	★☆☆☆☆ Found in Text Mining only
Oncocytoma renal	Associate	21590491, 37088465	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Associate	27443515	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	18246044, 27443515	★☆☆☆☆ Found in Text Mining only
Paraganglioma	Associate	32668278	★☆☆☆☆ Found in Text Mining only
Persistent Mullerian duct syndrome	Associate	20808915	★☆☆☆☆ Found in Text Mining only
Pleural Effusion	Associate	25337222	★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Associate	24859540	★☆☆☆☆ Found in Text Mining only
Pulmonary Sclerosing Hemangioma	Associate	25130377	★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Associate	21784970	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Associate	23358112, 25889870, 28349943, 31161851, 31263838, 31782890, 33011388, 36745184, 39392394, 9059352	★☆☆☆☆ Found in Text Mining only
Superior Vena Cava Syndrome	Associate	31983097	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Associate	36705380	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Associate	34751390	★☆☆☆☆ Found in Text Mining only
Thyroid Dysgenesis	Associate	30022773	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	18958156, 23358112, 31238008, 33813463, 36499466, 9854590	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Inhibit	19506552	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Associate	19506552, 23510370, 29381957, 31238008	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	28697743	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	19887917	★☆☆☆☆ Found in Text Mining only