Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	727
Gene name Gene Name - the full gene name approved by the HGNC.	Complement C5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	C5
Synonyms (NCBI Gene) Gene synonyms aliases	C5D, C5a, C5b, CPAMD4, ECLZB
Disease Acronyms (UniProt) Disease acronyms from UniProt database	C5D
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9q33.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a component of the complement system, a part of the innate immune system that plays an important role in inflammation, host homeostasis, and host defense against pathogens. The encoded preproprotein is proteolytically processed to genera

Show/Hide all(6)

SNP ID	Visualize variation	Clinical significance	Consequence
rs56040400	C>T	Affects	Genic downstream transcript variant, missense variant, coding sequence variant
rs121909587	G>A	Pathogenic	Coding sequence variant, stop gained, intron variant
rs121909588	G>A	Pathogenic	Coding sequence variant, stop gained, genic downstream transcript variant
rs373359894	G>A,T	Affects	Missense variant, genic downstream transcript variant, coding sequence variant
rs587776846	T>C	Pathogenic	Missense variant, coding sequence variant
rs1554718962	C>-	Likely-pathogenic	Genic downstream transcript variant, coding sequence variant, frameshift variant

Show/Hide all(29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016535	hsa-miR-193b-3p	Microarray	20304954
MIRT047564	hsa-miR-10a-5p	CLASH	23622248
MIRT848563	hsa-miR-1289	CLIP-seq
MIRT848564	hsa-miR-130a	CLIP-seq
MIRT848565	hsa-miR-130b	CLIP-seq
MIRT848566	hsa-miR-19a	CLIP-seq
MIRT848567	hsa-miR-19b	CLIP-seq
MIRT848568	hsa-miR-301a	CLIP-seq
MIRT848569	hsa-miR-301b	CLIP-seq
MIRT848570	hsa-miR-302a	CLIP-seq
MIRT848571	hsa-miR-302b	CLIP-seq
MIRT848572	hsa-miR-302c	CLIP-seq
MIRT848573	hsa-miR-302d	CLIP-seq
MIRT848574	hsa-miR-302e	CLIP-seq
MIRT848575	hsa-miR-3666	CLIP-seq
MIRT848576	hsa-miR-372	CLIP-seq
MIRT848577	hsa-miR-373	CLIP-seq
MIRT848578	hsa-miR-4295	CLIP-seq
MIRT848579	hsa-miR-4433	CLIP-seq
MIRT848580	hsa-miR-454	CLIP-seq
MIRT848581	hsa-miR-519a	CLIP-seq
MIRT848582	hsa-miR-519b-3p	CLIP-seq
MIRT848583	hsa-miR-519c-3p	CLIP-seq
MIRT848584	hsa-miR-520a-3p	CLIP-seq
MIRT848585	hsa-miR-520b	CLIP-seq
MIRT848586	hsa-miR-520c-3p	CLIP-seq
MIRT848587	hsa-miR-520d-3p	CLIP-seq
MIRT848588	hsa-miR-520e	CLIP-seq
MIRT848589	hsa-miR-548g	CLIP-seq

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000187	Process	Activation of MAPK activity	TAS	7649993
GO:0001701	Process	In utero embryonic development	IEA
GO:0004866	Function	Endopeptidase inhibitor activity	IEA
GO:0005102	Function	Signaling receptor binding	TAS	9590258, 10820279
GO:0005515	Function	Protein binding	IPI	19528535, 21217642, 25416956, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005579	Component	Membrane attack complex	IDA	22832194
GO:0005615	Component	Extracellular space	TAS	9218605
GO:0006935	Process	Chemotaxis	TAS	10820279
GO:0006954	Process	Inflammatory response	IEA
GO:0006957	Process	Complement activation, alternative pathway	IEA
GO:0006958	Process	Complement activation, classical pathway	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	10820279
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0008009	Function	Chemokine activity	TAS	10820279
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IDA	14566334, 16452172
GO:0010760	Process	Negative regulation of macrophage chemotaxis	IDA	14566334
GO:0010951	Process	Negative regulation of endopeptidase activity	IEA
GO:0019835	Process	Cytolysis	IEA
GO:0030449	Process	Regulation of complement activation	TAS
GO:0032722	Process	Positive regulation of chemokine production	IDA	14566334
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0060326	Process	Cell chemotaxis	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

MIM	HGNC	e!Ensembl
120900	1331	ENSG00000106804

Protein

UniProt ID

P01031

Protein name

Complement C5 (C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4) [Cleaved into: Complement C5 beta chain; Complement C5 alpha chain; C5a anaphylatoxin; Complement C5b (Complement C5 alpha' chain)]

Protein function

Precursor of the C5a anaphylatoxin and complement C5b components of the complement pathways, which consist in a cascade of proteins that leads to phagocytosis and breakdown of pathogens and signaling that strengthens the adaptive immune system (

PDB

1CFA , 1KJS , 1XWE , 3CU7 , 3HQA , 3HQB , 3KLS , 3KM9 , 3PRX , 3PVM , 4A5W , 4E0S , 4P39 , 4UU9 , 5B4P , 5B71 , 5HCC , 5HCD , 5HCE , 5I5K , 6H03 , 6H04 , 6RPT , 6RQJ , 7AD6 , 7AD7 , 7NYC , 7NYD , 7Y64 , 8B0F , 8B0G , 8B0H , 8HK5 , 8HQC , 8IA2 , 8JZZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17790	MG1	20 → 120	Macroglobulin domain MG1	Domain
PF01835	MG2	125 → 219	MG2 domain	Domain
PF17791	MG3	221 → 309	Macroglobulin domain MG3	Domain
PF17789	MG4	354 → 457	Macroglobulin domain MG4	Domain
PF07703	A2M_BRD	467 → 612	Alpha-2-macroglobulin bait region domain	Domain
PF01821	ANATO	698 → 732	Anaphylotoxin-like domain	Domain
PF00207	A2M	772 → 859	Alpha-2-macroglobulin family	Family
PF07678	TED_complement	977 → 1300	A-macroglobulin TED domain	Domain
PF07677	A2M_recep	1419 → 1509	A-macroglobulin receptor binding domain	Domain
PF01759	NTR	1550 → 1660	UNC-6/NTR/C345C module	Domain

Sequence

MGLLGILCFLIFLGKTWGQEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISIKSYP
DKKFSYSSGHVHLSSENKFQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPIT
YDNGFLFIHTDKPVYTPDQSVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHI
GIISFPDFKIPSNPRYGMWTIKAKYKEDFSTTGTAYFEVKEYVLPHFSVSIEPEYNFIGY
KNFKNFEITIKARYFYNKVVTEADVYITFGIREDLKDDQKEMMQTAMQNTMLINGIAQVT
FDSETAVKELSYYSLEDLNNKYLYIAVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATP
LFLKPGIPYPIKVQVKDSLDQLVGGVPVTLNAQTIDVNQETSDLDPSKSVTRVDDGVASF
VLNLPSGVTVLEFNVKTDAPDLPEENQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVGE
HLNIIVTPKSPYIDKITHYNYLILSKGKIIHFGTREKFSDASYQSINIPVTQNMVPSSRL
LVYYIVTGEQTAELVSDSVWLNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWV
ALAAVDSAVYGVQRGAKKPLERVFQFLEKSDLGCGAGGGLNNANVFHLAGLTFLTNANAD
DSQENDEPCKEILRPRRTLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISL
GPRCIKAFTECCVVASQLRANISHKDMQLGRLHMKTLLPVSKPEIRSYFPESWLWEVHLV
PRRKQLQFALPDSLTTWEIQGVGISNTGICVADTVKAKVFKDVFLEMNIPYSVVRGEQIQ
LKGTVYNYRTSGMQFCVKMSAVEGICTSESPVIDHQGTKSSKCVRQKVEGSSSHLVTFTV
LPLEIGLHNINFSLETWFGKEILVKTLRVVPEGVKRESYSGVTLDPRGIYGTISRRKEFP
YRIPLDLVPKTEIKRILSVKGLLVGEILSAVLSQEGINILTHLPKGSAEAELMSVVPVFY
VFHYLETGNHWNIFHSDPLIEKQKLKKKLKEGMLSIMSYRNADYSYSVWKGGSASTWLTA
FALRVLGQVNKYVEQNQNSICNSLLWLVENYQLDNGSFKENSQYQPIKLQGTLPVEAREN
SLYLTAFTVIGIRKAFDICPLVKIDTALIKADNFLLENTLPAQSTFTLAISAYALSLGDK
THPQFRSIVSALKREALVKGNPPIYRFWKDNLQHKDSSVPNTGTARMVETTAYALLTSLN
LKDINYVNPVIKWLSEEQRYGGGFYSTQDTINAIEGLTEYSLLVKQLRLSMDIDVSYKHK
GALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLK
IDTQDIEASHYRGYGNSDYKRIVACASYKPSREESSSGSSHAVMDISLPTGISANEEDLK
ALVEGVDQLFTDYQIKDGHVILQLNSIPSSDFLCVRFRIFELFEVGFLSPATFTVYEYHR
PDKQCTMFYSTSNIKIQKVCEGAACKCVEADCGQMQEELDLTISAETRKQTACKPEIAYA
YKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIM
GKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC

Sequence length

1676

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Complement and coagulation cascades Neutrophil extracellular trap formation Regulation of actin cytoskeleton Alcoholic liver disease Prion disease Pertussis Staphylococcus aureus infection Herpes simplex virus 1 infection Coronavirus disease - COVID-19 Systemic lupus erythematosus		Terminal pathway of complement Activation of C3 and C5 Peptide ligand-binding receptors G alpha (i) signalling events Regulation of Complement cascade

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Complement component deficiency	Complement deficiency disease, Complement component 5 deficiency	rs387906509, rs1467298230, rs1022194067, rs774370086, rs121964922, rs372345940, rs121913052, rs121913053, rs460897, rs121913054, rs121913056, rs121913058, rs796052138, rs41286844, rs121909592 View all (29 more)	25534848
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537	29212778
Immunodeficiency	Immunodeficiency due to a late component of complement deficiency	rs1565678077, rs121908002, rs1421444086, rs1565688667, rs944235493, rs121918314, rs587776713, rs137852678, rs587776714, rs128620188, rs2147483647, rs1569556522, rs137853331, rs137853332, rs179363866 View all (256 more)
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	19503088, 17804836

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Complement Component Deficiency	complement component 5 deficiency			GenCC

Show/Hide Text Mining Associations (42)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Coronary Syndrome	Associate	34002800
Arthritis Psoriatic	Associate	25725109
Arthritis Rheumatoid	Associate	18759306, 25566937, 25725109
Asthma	Associate	35205259
Atherosclerosis	Associate	32327104
Atypical Hemolytic Uremic Syndrome	Associate	24652797
Behcet Syndrome	Associate	26269006
Cognition Disorders	Associate	23662819
Complement component 5 deficiency	Associate	25534848
COVID 19	Associate	32961333, 35967361
Diabetes Gestational	Associate	36080270
Diabetes Mellitus Type 2	Associate	26934706
Diabetic Nephropathies	Associate	38069385
Diabetic Retinopathy	Associate	26989329
Epilepsy	Associate	38282487
Fetal Growth Retardation	Associate	38069155
Hepatitis Alcoholic	Associate	35490715
IgA Vasculitis	Associate	40717085
Infarction	Associate	27234505
Inflammation	Associate	17804836, 35205259
Joint Diseases	Associate	25566937
Lymphoma Non Hodgkin	Associate	19344414
Macular Degeneration	Associate	20022638
Meningococcal Infections	Associate	25534848
Metabolic Syndrome	Associate	19619703
N syndrome	Associate	32766853
Neoplasms	Associate	34839352
Neurologic Manifestations	Associate	38282487
Osteoarthritis	Associate	35406699
Parkinson Disease	Associate	33216044
Periodontitis	Associate	19909405
Pigmentary Disorder Reticulate with Systemic Manifestations	Associate	26989329
Pre Eclampsia	Stimulate	24296084
Pre Eclampsia	Associate	35373096
Premature Birth	Stimulate	37356366
Primary angiitis of the central nervous system	Associate	31270218
Protein Losing Enteropathies	Associate	33398182
Respiratory Distress Syndrome	Inhibit	32961333
Retinal Vein Occlusion	Associate	33270842
Status Asthmaticus	Associate	35205259
Substance Related Disorders	Associate	35967361
Vision Disorders	Associate	38282487

C5 (complement C5)