Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7266
Gene name	DnaJ heat shock protein family (Hsp40) member C7
Gene symbol	DNAJC7
Synonyms (NCBI Gene)	DJ11DJC7TPR2TTC2
Chromosome	17
Chromosome location	17q21.2
Summary	This gene encodes a member of the DNAJ heat shock protein 40 family of proteins that is characterized by two N-terminal tetratricopeptide repeat domains and a C-terminal DNAJ domain. This protein binds the chaperone proteins heat shock proteins 70 and 90

Show/Hide all (32)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025156	hsa-miR-181a-5p	Microarray	17612493
MIRT037064	hsa-miR-877-3p	CLASH	23622248
MIRT941784	hsa-miR-1321	CLIP-seq
MIRT941785	hsa-miR-181a	CLIP-seq
MIRT941786	hsa-miR-181b	CLIP-seq
MIRT941787	hsa-miR-181c	CLIP-seq
MIRT941788	hsa-miR-181d	CLIP-seq
MIRT941789	hsa-miR-3179	CLIP-seq
MIRT941790	hsa-miR-3545-3p	CLIP-seq
MIRT941791	hsa-miR-3689d	CLIP-seq
MIRT941792	hsa-miR-3692	CLIP-seq
MIRT941793	hsa-miR-4262	CLIP-seq
MIRT941794	hsa-miR-4314	CLIP-seq
MIRT941795	hsa-miR-452	CLIP-seq
MIRT941796	hsa-miR-4676-3p	CLIP-seq
MIRT941797	hsa-miR-4739	CLIP-seq
MIRT941798	hsa-miR-4756-5p	CLIP-seq
MIRT941799	hsa-miR-4765	CLIP-seq
MIRT941800	hsa-miR-548g	CLIP-seq
MIRT941801	hsa-miR-765	CLIP-seq
MIRT941802	hsa-miR-1323	CLIP-seq
MIRT941803	hsa-miR-22	CLIP-seq
MIRT941804	hsa-miR-3202	CLIP-seq
MIRT941805	hsa-miR-339-5p	CLIP-seq
MIRT941806	hsa-miR-4476	CLIP-seq
MIRT941807	hsa-miR-4753-3p	CLIP-seq
MIRT941808	hsa-miR-548o	CLIP-seq
MIRT1978788	hsa-miR-1281	CLIP-seq
MIRT1978789	hsa-miR-1470	CLIP-seq
MIRT1978790	hsa-miR-331-3p	CLIP-seq
MIRT1978791	hsa-miR-4469	CLIP-seq
MIRT1978792	hsa-miR-4667-3p	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001671	Function	ATPase activator activity	TAS
GO:0005515	Function	Protein binding	IPI	17043677, 22190034, 25036637, 26496610, 31413325, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	12853476
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006457	Process	Protein folding	IDA	12853476, 18620420
GO:0006457	Process	Protein folding	TAS	8836031
GO:0016020	Component	Membrane	HDA	19946888
GO:0031072	Function	Heat shock protein binding	IPI	12853476
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:1900034	Process	Regulation of cellular response to heat	TAS

MIM	HGNC	e!Ensembl
601964	12392	ENSG00000168259

Q99615

Protein name

DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2)

Protein function

Acts as a co-chaperone regulating the molecular chaperones HSP70 and HSP90 in folding of steroid receptors, such as the glucocorticoid receptor and the progesterone receptor. Proposed to act as a recycling chaperone by facilitating the return of

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13414	TPR_11	35 → 76		Repeat
PF13432	TPR_16	186 → 244		Family
PF13181	TPR_8	294 → 327	Tetratricopeptide repeat	Repeat
PF13181	TPR_8	328 → 360	Tetratricopeptide repeat	Repeat
PF00226	DnaJ	381 → 448	DnaJ domain	Domain

Sequence

MAAAAECDVVMAATEPELLDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPK
NASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQ
RALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKI
LKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMA
PDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNR
GTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKT
KEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEV
QKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFS
FEASGPGNFFFQFG

Sequence length

494

Interactions

View interactions

	Reactome
			Regulation of HSF1-mediated heat shock response

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Amyotrophic lateral sclerosis	Uncertain significance	ClinVar ClinGen, Disgenet, GenCC ClinGen, Disgenet, GenCC	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
HIV INFECTIONS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental delay	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Amyotrophic Lateral Sclerosis	Associate	31768050	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Carcinoma Renal Cell	Stimulate	26993597	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Associate	35218958	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	40234584	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Associate	31768050	★★★★★ ★☆☆☆☆ Found in Text Mining only

DNAJC7 (DnaJ heat shock protein family (Hsp40) member C7)