Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7263
Gene name Gene Name - the full gene name approved by the HGNC.	Thiosulfate sulfurtransferase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TST
Synonyms (NCBI Gene) Gene synonyms aliases	RDS
Disease Acronyms (UniProt) Disease acronyms from UniProt database	RDS
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q12.3
Summary Summary of gene provided in NCBI Entrez Gene.	This is one of two neighboring genes encoding similar proteins that each contain two rhodanese domains. The encoded protein is localized to the mitochondria and catalyzes the conversion of thiosulfate and cyanide to thiocyanate and sulfite. In addition, t

Show/Hide all(58)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016237	hsa-miR-548b-3p	Sequencing	20371350
MIRT032127	hsa-let-7d-5p	Sequencing	20371350
MIRT032251	hsa-let-7b-5p	Proteomics	18668040
MIRT1460633	hsa-miR-101	CLIP-seq
MIRT1460634	hsa-miR-144	CLIP-seq
MIRT1460635	hsa-miR-145	CLIP-seq
MIRT1460636	hsa-miR-1537	CLIP-seq
MIRT1460637	hsa-miR-1825	CLIP-seq
MIRT1460638	hsa-miR-199a-5p	CLIP-seq
MIRT1460639	hsa-miR-199b-5p	CLIP-seq
MIRT1460640	hsa-miR-205	CLIP-seq
MIRT1460641	hsa-miR-224	CLIP-seq
MIRT1460642	hsa-miR-298	CLIP-seq
MIRT1460643	hsa-miR-3120-3p	CLIP-seq
MIRT1460644	hsa-miR-412	CLIP-seq
MIRT1460645	hsa-miR-4511	CLIP-seq
MIRT1460646	hsa-miR-4792	CLIP-seq
MIRT1460647	hsa-miR-4799-5p	CLIP-seq
MIRT1460648	hsa-miR-548ac	CLIP-seq
MIRT1460649	hsa-miR-548ae	CLIP-seq
MIRT1460650	hsa-miR-548aj	CLIP-seq
MIRT1460651	hsa-miR-548am	CLIP-seq
MIRT1460652	hsa-miR-548an	CLIP-seq
MIRT1460653	hsa-miR-548d-3p	CLIP-seq
MIRT1460654	hsa-miR-548x	CLIP-seq
MIRT1460655	hsa-miR-548z	CLIP-seq
MIRT1460656	hsa-miR-561	CLIP-seq
MIRT1460657	hsa-miR-582-5p	CLIP-seq
MIRT1460658	hsa-miR-615-5p	CLIP-seq
MIRT1460659	hsa-miR-935	CLIP-seq
MIRT1460633	hsa-miR-101	CLIP-seq
MIRT1460634	hsa-miR-144	CLIP-seq
MIRT1460636	hsa-miR-1537	CLIP-seq
MIRT1460641	hsa-miR-224	CLIP-seq
MIRT1460657	hsa-miR-582-5p	CLIP-seq
MIRT1460658	hsa-miR-615-5p	CLIP-seq
MIRT1460659	hsa-miR-935	CLIP-seq
MIRT1460633	hsa-miR-101	CLIP-seq
MIRT1460634	hsa-miR-144	CLIP-seq
MIRT1460636	hsa-miR-1537	CLIP-seq
MIRT1460640	hsa-miR-205	CLIP-seq
MIRT1460641	hsa-miR-224	CLIP-seq
MIRT1460642	hsa-miR-298	CLIP-seq
MIRT1460644	hsa-miR-412	CLIP-seq
MIRT1460645	hsa-miR-4511	CLIP-seq
MIRT1460657	hsa-miR-582-5p	CLIP-seq
MIRT1460658	hsa-miR-615-5p	CLIP-seq
MIRT1460659	hsa-miR-935	CLIP-seq
MIRT1460643	hsa-miR-3120-3p	CLIP-seq
MIRT1460646	hsa-miR-4792	CLIP-seq
MIRT1460647	hsa-miR-4799-5p	CLIP-seq
MIRT1460648	hsa-miR-548ac	CLIP-seq
MIRT1460649	hsa-miR-548ae	CLIP-seq
MIRT1460650	hsa-miR-548aj	CLIP-seq
MIRT1460651	hsa-miR-548am	CLIP-seq
MIRT1460653	hsa-miR-548d-3p	CLIP-seq
MIRT1460654	hsa-miR-548x	CLIP-seq
MIRT1460655	hsa-miR-548z	CLIP-seq

Show/Hide all(13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000098	Process	Sulfur amino acid catabolic process	TAS
GO:0004792	Function	Thiosulfate sulfurtransferase activity	IBA	21873635
GO:0004792	Function	Thiosulfate sulfurtransferase activity	TAS
GO:0005615	Component	Extracellular space	HDA	23580065
GO:0005739	Component	Mitochondrion	IBA	21873635
GO:0005739	Component	Mitochondrion	IDA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0008097	Function	5S rRNA binding	IDA	20663881, 21685364
GO:0009440	Process	Cyanate catabolic process	TAS	9070219
GO:0019346	Process	Transsulfuration	IBA	21873635
GO:0030855	Process	Epithelial cell differentiation	IDA	21492153
GO:0035928	Process	RRNA import into mitochondrion	IMP	20663881
GO:0051029	Process	RRNA transport	IDA	21685364

MIM	HGNC	e!Ensembl
180370	12388	ENSG00000128311

Protein

UniProt ID

Q16762

Protein name

Thiosulfate sulfurtransferase (EC 2.8.1.1) (Rhodanese)

Protein function

Formation of iron-sulfur complexes, cyanide detoxification or modification of sulfur-containing enzymes. Other thiol compounds, besides cyanide, can act as sulfur ion acceptors. Also has weak mercaptopyruvate sulfurtransferase (MST) activity (By

PDB

8AGF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00581	Rhodanese	12 → 137	Rhodanese-like domain	Domain
PF00581	Rhodanese	164 → 282	Rhodanese-like domain	Domain

Sequence

MVHQVLYRALVSTKWLAESIRTGKLGPGLRVLDASWYSPGTREARKEYLERHVPGASFFD
IEECRDTASPYEMMLPSEAGFAEYVGRLGISNHTHVVVYDGEHLGSFYAPRVWWMFRVFG
HRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAVFKATLDRSLLKTYEQVLENLESKRFQLV
DSRSQGRFLGTEPEPDAVGLDSGHIRGAVNMPFMDFLTEDGFEKGPEELRALFQTKKVDL
SQPLIATCRKGVTACHVALAAYLCGKPDVAVYDGSWSEWFRRAPPESRVSQGKSEKA

Sequence length

297

Interactions

View interactions

	KEGG		Reactome
	Cysteine and methionine metabolism Sulfur metabolism Metabolic pathways Sulfur relay system		Degradation of cysteine and homocysteine

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17013881

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	37715200
Aortic Valve Stenosis	Associate	36780769
Calcinosis	Associate	36780769
Carcinoma Hepatocellular	Associate	29466730
Colitis Ulcerative	Associate	16500920
Colorectal Neoplasms	Inhibit	16500920
Inflammation	Associate	16500920
Neoplasm Metastasis	Associate	35067686
Neoplasms	Inhibit	16500920
Neoplasms	Associate	29466730, 35067686, 36343244
Neurodegenerative Diseases	Associate	33296712

TST (thiosulfate sulfurtransferase)