Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	723961
Gene name Gene Name - the full gene name approved by the HGNC.	INS-IGF2 readthrough
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	INS-IGF2
Synonyms (NCBI Gene) Gene synonyms aliases	INSIGF
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p15.5
Summary Summary of gene provided in NCBI Entrez Gene.	This locus includes two alternatively spliced read-through transcript variants which align to the INS gene in the 5` region and to the IGF2 gene in the 3` region. One transcript is predicted to encode a protein which shares the N-terminus with the INS pro

Show/Hide all(15)

miRTarBase ID	miRNA	Experiments
MIRT1067729	hsa-miR-1205	CLIP-seq
MIRT1067730	hsa-miR-2467-5p	CLIP-seq
MIRT1067731	hsa-miR-3183	CLIP-seq
MIRT1067732	hsa-miR-3188	CLIP-seq
MIRT1067733	hsa-miR-3975	CLIP-seq
MIRT1067734	hsa-miR-4259	CLIP-seq
MIRT1067735	hsa-miR-4260	CLIP-seq
MIRT1067736	hsa-miR-4283	CLIP-seq
MIRT1067737	hsa-miR-4489	CLIP-seq
MIRT1067738	hsa-miR-4505	CLIP-seq
MIRT1067739	hsa-miR-4649-3p	CLIP-seq
MIRT1067740	hsa-miR-4656	CLIP-seq
MIRT1067741	hsa-miR-4723-3p	CLIP-seq
MIRT1067742	hsa-miR-4731-5p	CLIP-seq
MIRT1067743	hsa-miR-485-5p	CLIP-seq

Show/Hide all(6)

GO ID	Ontology	Definition	Evidence
GO:0005158	Function	Insulin receptor binding	IBA
GO:0005179	Function	Hormone activity	IBA
GO:0005179	Function	Hormone activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0007165	Process	Signal transduction	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein

UniProt ID

F8WCM5

Protein name

Insulin, isoform 2 (INS-IGF2 readthrough transcript protein)

PDB

7YQ3 , 7YQ4 , 7YQ5 , 8GUY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00049	Insulin	28 → 168	Insulin/IGF/Relaxin family	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in pancreas, eye and, to a lower extent, in limb. {ECO:0000269|PubMed:16531418}.

Sequence

MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
LQASALSLSSSTSTWPEGLDATARAPPALVVTANIGQAGGSSSRQFRQRALGTSDSPVLF
IHCPGAAGTAQGLEYRGRRVTTELVWEEVDSSPQPQGSESLPAQPPAQPAPQPEPQQARE
PSPEVSCCGLWPRRPQRSQN

Sequence length

200

Interactions

View interactions

INS-IGF2 (INS-IGF2 readthrough)