Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7226
Gene name Gene Name - the full gene name approved by the HGNC.	Transient receptor potential cation channel subfamily M member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TRPM2
Synonyms (NCBI Gene) Gene synonyms aliases	EREG1, KNP3, LTRPC2, LTrpC-2, NUDT9H, NUDT9L1, TRPC7
Chromosome Chromosome number	21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	21q22.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene forms a tetrameric cation channel that is permeable to calcium, sodium, and potassium and is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to ce

Show/Hide all(38)

miRTarBase ID	miRNA	Experiments	Reference
MIRT042627	hsa-miR-423-3p	CLASH	23622248
MIRT1457298	hsa-miR-1269	CLIP-seq
MIRT1457299	hsa-miR-1269b	CLIP-seq
MIRT1457300	hsa-miR-1288	CLIP-seq
MIRT1457301	hsa-miR-1324	CLIP-seq
MIRT1457302	hsa-miR-1909	CLIP-seq
MIRT1457303	hsa-miR-3616-3p	CLIP-seq
MIRT1457304	hsa-miR-3660	CLIP-seq
MIRT1457305	hsa-miR-4271	CLIP-seq
MIRT1457306	hsa-miR-4293	CLIP-seq
MIRT1457307	hsa-miR-4433	CLIP-seq
MIRT1457308	hsa-miR-4459	CLIP-seq
MIRT1457309	hsa-miR-4515	CLIP-seq
MIRT1457310	hsa-miR-4526	CLIP-seq
MIRT1457311	hsa-miR-4632	CLIP-seq
MIRT1457312	hsa-miR-4645-3p	CLIP-seq
MIRT1457313	hsa-miR-4721	CLIP-seq
MIRT1457314	hsa-miR-4725-3p	CLIP-seq
MIRT1457315	hsa-miR-4740-5p	CLIP-seq
MIRT1457316	hsa-miR-4768-3p	CLIP-seq
MIRT1457317	hsa-miR-4786-3p	CLIP-seq
MIRT1457318	hsa-miR-544b	CLIP-seq
MIRT1457319	hsa-miR-671-5p	CLIP-seq
MIRT2137124	hsa-miR-1286	CLIP-seq
MIRT2137125	hsa-miR-3155	CLIP-seq
MIRT2137126	hsa-miR-3155b	CLIP-seq
MIRT2137127	hsa-miR-3677-5p	CLIP-seq
MIRT2137128	hsa-miR-4323	CLIP-seq
MIRT2137129	hsa-miR-4435	CLIP-seq
MIRT2137130	hsa-miR-4436a	CLIP-seq
MIRT2137131	hsa-miR-4514	CLIP-seq
MIRT2137132	hsa-miR-4645-5p	CLIP-seq
MIRT2137133	hsa-miR-4673	CLIP-seq
MIRT2137134	hsa-miR-4692	CLIP-seq
MIRT2137135	hsa-miR-4755-3p	CLIP-seq
MIRT2137136	hsa-miR-484	CLIP-seq
MIRT2357943	hsa-miR-4771	CLIP-seq
MIRT2357944	hsa-miR-499a-5p	CLIP-seq

Show/Hide all(51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001659	Process	Temperature homeostasis	ISS
GO:0002407	Process	Dendritic cell chemotaxis	ISS
GO:0005261	Function	Cation channel activity	IBA	21873635
GO:0005261	Function	Cation channel activity	IMP	27068538
GO:0005262	Function	Calcium channel activity	TAS	9806837
GO:0005272	Function	Sodium channel activity	IEA
GO:0005509	Function	Calcium ion binding	IDA	30467180
GO:0005509	Function	Calcium ion binding	IMP	19171771
GO:0005764	Component	Lysosome	IDA	27068538
GO:0005765	Component	Lysosomal membrane	ISS
GO:0005886	Component	Plasma membrane	IDA	27333281
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	IDA	30467180
GO:0005887	Component	Integral component of plasma membrane	IMP	19171771
GO:0005887	Component	Integral component of plasma membrane	ISS
GO:0006816	Process	Calcium ion transport	TAS	9806837
GO:0014074	Process	Response to purine-containing compound	IMP	19171771
GO:0015278	Function	Calcium-release channel activity	IMP	27068538
GO:0016787	Function	Hydrolase activity	IMP	27383051
GO:0030659	Component	Cytoplasmic vesicle membrane	ISS
GO:0035579	Component	Specific granule membrane	TAS
GO:0035584	Process	Calcium-mediated signaling using intracellular calcium source	ISS
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0047631	Function	ADP-ribose diphosphatase activity	IDA	30467180
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IBA	21873635
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IMP	27068538
GO:0051209	Process	Release of sequestered calcium ion into cytosol	ISS
GO:0051289	Process	Protein homotetramerization	IDA	30467180
GO:0051489	Process	Regulation of filopodium assembly	IMP	27068538
GO:0070301	Process	Cellular response to hydrogen peroxide	IDA	27068538
GO:0070588	Process	Calcium ion transmembrane transport	IBA	21873635
GO:0070588	Process	Calcium ion transmembrane transport	IDA	25620041, 27333281, 28775320, 29745897, 30467180
GO:0070588	Process	Calcium ion transmembrane transport	TAS
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0071277	Process	Cellular response to calcium ion	IMP	19171771
GO:0071415	Process	Cellular response to purine-containing compound	ISS
GO:0071502	Process	Cellular response to temperature stimulus	ISS
GO:0071577	Process	Zinc ion transmembrane transport	IMP	27068538
GO:0072571	Function	Mono-ADP-D-ribose binding	IDA	30467180
GO:0097028	Process	Dendritic cell differentiation	ISS
GO:0097553	Process	Calcium ion transmembrane import into cytosol	IMP	19171771, 27068538
GO:0098655	Process	Cation transmembrane transport	IBA	21873635
GO:0098703	Process	Calcium ion import across plasma membrane	ISS
GO:0099604	Function	Ligand-gated calcium channel activity	IBA	21873635
GO:0099604	Function	Ligand-gated calcium channel activity	IDA	19171771, 25620041, 27333281, 28775320, 29745897, 30467180
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS
GO:2000249	Process	Regulation of actin cytoskeleton reorganization	IMP	27068538

MIM	HGNC	e!Ensembl
603749	12339	ENSG00000142185

Protein

UniProt ID

O94759

Protein name

Transient receptor potential cation channel subfamily M member 2 (Estrogen-responsive element-associated gene 1 protein) (Long transient receptor potential channel 2) (LTrpC-2) (LTrpC2) (Transient receptor potential channel 7) (TrpC7) (Transient receptor

Protein function

[Isoform 1]: Nonselective, voltage-independent cation channel that mediates Na(+) and Ca(2+) influx, leading to increased cytoplasmic Ca(2+) levels (PubMed:11385575, PubMed:11509734, PubMed:11804595, PubMed:12594222, PubMed:15561722, PubMed:1660

PDB

6MIX , 6MIZ , 6MJ2 , 6PUO , 6PUR , 6PUS , 6PUU , 7VQ1 , 7VQ2 , 8E6Q , 8E6R , 8E6S , 8E6T , 8E6U , 8E6V

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18139	LSDAT_euk	140 → 408	SLOG in TRPM	Family
PF00520	Ion_trans	797 → 1060	Ion transport protein	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in brain and peripheral blood cells, such as neutrophils. Also detected in bone marrow, spleen, heart, liver and lung. Isoform 2 is found in neutrophil granulocytes. {ECO:0000269|PubMed:11385575, ECO:0000269|PubMed:115

Sequence

MEPSALRKAGSEQEEGFEGLPRRVTDLGMVSNLRRSNSSLFKSWRLQCPFGNNDKQESLS
SWIPENIKKKECVYFVESSKLSDAGKVVCQCGYTHEQHLEEATKPHTFQGTQWDPKKHVQ
EMPTDAFGDIVFTGLSQKVKKYVRVSQDTPSSVIYHLMTQHWGLDVPNLLISVTGGAKNF
NMKPRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSYKEGELITIG
VATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSNHSHFILVDDGTHGQYGVEIP
LRTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTNGTPCVVVEGSGRVA
DVIAQVANLPVSDITISLIQQKLSVFFQEMFETFTESRIVEWTKKIQDIVRRRQLLTVFR
EGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK
PSDLHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLYENLDPSCLFHSKLQKVL
VEDPERPACAPAAPRLQMHHVAQVLRELLGDFTQPLYPRPRHNDRLRLLLPVPHVKLNVQ
GVSLRSLYKRSSGHVTFTMDPIRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILK
ELSKEEEDTDSSEEMLALAEEYEHRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQL
ALEAKDMKFVSHGGIQAFLTKVWWGQLSVDNGLWRVTLCMLAFPLLLTGLISFREKRLQD
VGTPAARARAFFTAPVVVFHLNILSYFAFLCLFAYVLMVDFQPVPSWCECAIYLWLFSLV
CEEMRQLFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAGLTCRLIPATLYPGRVILS
LDFILFCLRLMHIFTISKTLGPKIIIVKRMMKDVFFFLFLLAVWVVSFGVAKQAILIHNE
RRVDWLFRGAVYHSYLTIFGQIPGYIDGVNFNPEHCSPNGTDPYKPKCPESDATQQRPAF
PEWLTVLLLCLYLLFTNILLLNLLIAMFNYTFQQVQEHTDQIWKFQRHDLIEEYHGRPAA
PPPFILLSHLQLFIKRVVLKTPAKRHKQLKNKLEKNEEAALLSWEIYLKENYLQNRQFQQ
KQRPEQKIEDISNKVDAMVDLLDLDPLKRSGSMEQRLASLEEQVAQTAQALHWIVRTLRA
SGFSSEADVPTLASQKAAEEPDAEPGGRKKTEEPGDSYHVNARHLLYPNCPVTRFPVPNE
KVPWETEFLIYDPPFYTAERKDAAAMDPMGDTLEPLSTIQYNVVDGLRDRRSFHGPYTVQ
AGLPLNPMGRTGLRGRGSLSCFGPNHTLYPMVTRWRRNEDGAICRKSIKKMLEVLVVKLP
LSEHWALPGGSREPGEMLPRKLKRILRQEHWPSFENLLKCGMEVYKGYMDDPRNTDNAWI
ETVAVSVHFQDQNDVELNRLNSNLHACDSGASIRWQVVDRRIPLYANHKTLLQKAAAEFG
AHY

Sequence length

1503

Interactions

View interactions

	KEGG		Reactome
	NOD-like receptor signaling pathway Oxytocin signaling pathway		TRP channels Neutrophil degranulation

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Parkinson disease	Parkinson Disease	rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432 View all (84 more)	27957685

Show/Hide Text Mining Associations (57)

Disease Name	Relationship Type	References
Associations from Text Mining
Amyotrophic Lateral Sclerosis	Associate	19004782
Aortic Coarctation	Associate	25984793
Asthma	Associate	34903714
Atrial Fibrillation	Stimulate	28839241
Attention Deficit Disorder with Hyperactivity	Associate	28332277
Brain Damage Chronic	Associate	30229906
Brain Injuries	Associate	31772034
Breast Neoplasms	Associate	25760245, 26178079, 30810442
Carcinogenesis	Associate	34605693, 35156509
Carcinoma Non Small Cell Lung	Associate	28678322
Carcinoma Pancreatic Ductal	Associate	29620272
Carcinoma Renal Cell	Stimulate	36619219, 8263017
Crohn Disease	Associate	23615072
Diabetes Mellitus	Associate	28108595
Diabetes Mellitus Type 2	Associate	27731349
Drug Related Side Effects and Adverse Reactions	Associate	26178079
Endometrial Hyperplasia	Associate	30997980
Endometrial Neoplasms	Associate	30997980, 35854199
Esophageal Neoplasms	Associate	35156509
Esophageal Squamous Cell Carcinoma	Associate	34605693
Fatigue Syndrome Chronic	Associate	31796045, 34831634
Genetic Diseases Inborn	Associate	33494993
Glioblastoma	Associate	18225560, 26088448
Heart Arrest	Associate	31772034
Heredodegenerative Disorders Nervous System	Associate	31772034
Hyperglycemia	Stimulate	27731349
Hypoxia	Associate	32296107
Inflammation	Associate	32296107, 34903714
Ischemia	Stimulate	28108595
Leukemia	Stimulate	32312983
Leukemia Myeloid	Associate	32312983
Leukemia Myeloid Acute	Associate	32312983
Leukemia Myeloid Acute	Inhibit	32423430
Leukemia T Cell	Associate	26839633
Low Back Pain	Associate	31827137
Lysosomal Storage Diseases	Associate	30229906
Malformations of Cortical Development Group I	Stimulate	32296107
Melanoma	Associate	22897572, 34445066
Mitochondrial Diseases	Associate	35881053
Necrosis	Stimulate	18225560, 22897572
Neoplasm Metastasis	Associate	35156509
Neoplasms	Associate	27694440, 28008929, 29343514, 30020827, 31772034, 35100080, 35428820, 36619219
Neoplasms	Stimulate	34605693
Neoplasms Squamous Cell	Associate	31780732
Nerve Degeneration	Associate	30229906, 32296107
Neuroblastoma	Associate	23302782, 27694440, 30020827, 30229906, 30625984, 35428820, 36446940
Osteoglophonic dwarfism	Associate	34117854
Osteosarcoma	Associate	35100080
Ovarian Neoplasms	Associate	33621194, 37608401
Pain	Associate	31772034, 31827137
Parkinson Disease	Associate	30625984
Progressive supranuclear palsy atypical	Associate	19004782
Prostatic Neoplasms	Associate	20029400, 27068538
Squamous Cell Carcinoma of Head and Neck	Associate	28008929
Stomach Neoplasms	Associate	29343514, 34696681
Stroke	Associate	31772034
Tongue Neoplasms	Associate	28008929

TRPM2 (transient receptor potential cation channel subfamily M member 2)